StarFunc result for job id Q9UDV6

User Input

>input (495 residues)
MAESAPARHRRKRRSTPLTSSTLPSQATEKSSYFQTTEISLWTVVAAIQAVEKKMESQAA
RLQSLEGRTGTAEKKLADCEKMAVEFGNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRN
RNFWILRLPPGSKGEAPKVSRSLENDGVCFTEQEWENLEDWQKELYRNVMESNYETLVSL
KVLGQTEGEAELGTEMLGDLEEEGPGGAHPAGGVMIKQELQYTQEGPADLPGEFSCIAEE
QAFLSPEQTELWGGQGSSVLLETGPGDSTLEEPVGSRVPSSSRTVGCPKQKSHRQVQLDQ
ECGQGLKLKKDTSRPYECSECEITFRYKQQLATHLRSHSGWGSCTPEEPEESLRPRPRLK
PQTKKAKLHQCDVCLRSFSCKVSLVTHQRCHLQEGPSAGQHVQERFSPNSLVALPGHIPW
RKSRSSLICGYCGKSFSHPSDLVRHQRIHTGERPYSCTECEKSFVQKQHLLQHQKIHQRE
RGGLALEPGRPNGLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A090N8N3	0.242	0.242	2.459E-73	495	1.000	1.000	A0A090N8N3.pdb.gz	A0A090N8N3_HUMAN Zinc finger protein 212 OS=Homo sapiens OX=9606 GN=ZNF212 PE=4 SV=1
2	AFDB:Q6ZPF1	0.233	0.232	6.582E-60	496	0.784	0.782	Q6ZPF1.pdb.gz	Q6ZPF1_MOUSE MKIAA3011 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp212 PE=2 SV=1
3	AFDB:Q9ULD5	0.199	0.125	5.190E-26	831	0.444	0.265	Q9ULD5.pdb.gz	ZN777_HUMAN Zinc finger protein 777 OS=Homo sapiens OX=9606 GN=ZNF777 PE=1 SV=3
4	AFDB:O43296	0.145	0.120	5.190E-13	627	0.200	0.158	O43296.pdb.gz	ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens OX=9606 GN=ZNF264 PE=1 SV=1
5	AFDB:P16373	0.118	0.093	1.692E-12	634	0.147	0.115	P16373.pdb.gz	ZFP59_MOUSE Zinc finger protein 59 OS=Mus musculus OX=10090 GN=Zfp59 PE=1 SV=3
6	AFDB:P59923	0.127	0.065	2.508E-12	1031	0.210	0.101	P59923.pdb.gz	ZN445_HUMAN Zinc finger protein 445 OS=Homo sapiens OX=9606 GN=ZNF445 PE=1 SV=1
7	AFDB:Q7Z3I7	0.120	0.114	3.951E-11	529	0.166	0.155	Q7Z3I7.pdb.gz	ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens OX=9606 GN=ZNF572 PE=1 SV=1
8	AFDB:Q8NAM6	0.113	0.128	9.904E-11	433	0.164	0.187	Q8NAM6.pdb.gz	ZSCA4_HUMAN Zinc finger and SCAN domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZSCAN4 PE=1 SV=1
9	AFDB:Q8IGK0	0.103	0.092	1.788E-10	561	0.160	0.141	Q8IGK0.pdb.gz	Q8IGK0_DROME RE74316p OS=Drosophila melanogaster OX=7227 GN=cg PE=2 SV=1
10	AFDB:Q9Y5A6	0.125	0.130	4.198E-10	473	0.208	0.218	Q9Y5A6.pdb.gz	ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZSCAN21 PE=1 SV=2
11	PDB:3w5kB	0.088	0.244	1.832E-2	110	0.065	0.291	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:3jcmI	0.059	0.069	8.251E-1	416	0.034	0.041	3jcmI.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
13	PDB:4z4kA	0.065	0.099	8.810E-1	282	0.024	0.043	4z4kA.pdb.gz	A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.
14	PDB:6t9lN	0.051	0.266	1.490	82	0.030	0.183	6t9lN.pdb.gz	Structure of the transcription coactivator SAGA.
15	PDB:7dvq9	0.047	0.054	1.490	409	0.055	0.066	7dvq9.pdb.gz	Structure of the activated human minor spliceosome.
16	PDB:6ydhA	0.035	0.208	1.591	62	0.016	0.129	6ydhA.pdb.gz
17	PDB:7uhyC	0.050	0.045	2.068	578	0.036	0.031	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
18	PDB:5dkaA	0.067	0.251	2.358	96	0.034	0.177	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
19	PDB:7uhyA	0.035	0.024	2.518	771	0.026	0.017	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
20	PDB:4btsA9	0.050	0.159	2.689	93	0.032	0.172	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A090N8N3	0.0	1011	495	1.000	1.000	A0A090N8N3_HUMAN Zinc finger protein 212 OS=Homo sapiens OX=9606 GN=ZNF212 PE=4 SV=1
2	G3X8R7	0.0	790	492	0.794	0.799	G3X8R7_MOUSE Zinc finger protein 212 OS=Mus musculus OX=10090 GN=Zfp212 PE=1 SV=1
3	Q6P238	0.0	777	486	0.784	0.798	Q6P238_MOUSE Zinc finger protein 212 (Fragment) OS=Mus musculus OX=10090 GN=Zfp212 PE=2 SV=1
4	Q6ZPF1	0.0	785	496	0.792	0.790	Q6ZPF1_MOUSE MKIAA3011 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp212 PE=2 SV=1
5	Q9UDV6	0.0	1011	495	1.000	1.000	ZN212_HUMAN Zinc finger protein 212 OS=Homo sapiens OX=9606 GN=ZNF212 PE=1 SV=3
6	Q922Y8	3.41e-170	484	323	0.491	0.752	Q922Y8_MOUSE Zinc finger protein 212 OS=Mus musculus OX=10090 GN=Zfp212 PE=2 SV=1
7	Q6ZMS7	1.84e-106	329	546	0.463	0.419	ZN783_HUMAN Zinc finger protein 783 OS=Homo sapiens OX=9606 GN=ZNF783 PE=1 SV=2
8	Q8TD17	5.40e-94	300	642	0.448	0.346	ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens OX=9606 GN=ZNF398 PE=1 SV=1
9	A0A2R8YDQ5	1.84e-70	238	659	0.232	0.175	A0A2R8YDQ5_HUMAN Zinc finger protein 746 OS=Homo sapiens OX=9606 GN=ZNF746 PE=1 SV=1
10	Q9UDV7	1.28e-68	234	671	0.222	0.164	ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens OX=9606 GN=ZNF282 PE=1 SV=3
11	B7Z3E8	3.27e-68	220	244	0.228	0.463	B7Z3E8_HUMAN cDNA FLJ51208 OS=Homo sapiens OX=9606 PE=1 SV=1
12	Q9ULD5	7.16e-68	234	831	0.279	0.166	ZN777_HUMAN Zinc finger protein 777 OS=Homo sapiens OX=9606 GN=ZNF777 PE=1 SV=3
13	Q6NUN9	6.26e-63	218	644	0.222	0.171	ZN746_HUMAN Zinc finger protein 746 OS=Homo sapiens OX=9606 GN=ZNF746 PE=1 SV=1
14	Q3U133	4.27e-62	216	652	0.248	0.189	ZN746_MOUSE Zinc finger protein 746 OS=Mus musculus OX=10090 GN=Znf746 PE=1 SV=3
15	Q86U76	7.62e-32	128	410	0.222	0.268	Q86U76_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=1
16	P17036	1.11e-31	128	446	0.222	0.247	ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=3
17	Q9GZX5	5.22e-28	119	532	0.224	0.209	ZN350_HUMAN Zinc finger protein 350 OS=Homo sapiens OX=9606 GN=ZNF350 PE=1 SV=3
18	Q96PE6	1.91e-27	117	472	0.218	0.229	ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens OX=9606 GN=ZIM3 PE=1 SV=1
19	Q9C0F3	2.22e-27	116	470	0.228	0.240	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
20	P10755	1.35e-26	114	501	0.222	0.220	ZFP14_MOUSE Zinc finger protein 14 OS=Mus musculus OX=10090 GN=Zfp14 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01352 KRAB	2.5e-09	47.9	KRAB box
2	PF00096 zf-C2H2	2.2e-12	57.8	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	4.8e-08	44.2	C2H2-type zinc finger
4	PF13912 zf-C2H2_6	0.00056	31.1	C2H2-type zinc finger
5	PF15909 zf-C2H2_8	14	17.4	C2H2-type zinc ribbon
6	PF12171 zf-C2H2_jaz	3.9	19.1	Zinc-finger double-stranded RNA-binding
7	PF13913 zf-C2HC_2	7.6	17.8	zinc-finger of a C2HC-type
8	PF13465 zf-H2C2_2	5.6e-06	37.7	Zinc-finger double domain
9	PF12874 zf-met	3.3	19.4	Zinc-finger of C2H2 type
10	PF17032 zinc_ribbon_15	8.6e+02	12.1	zinc-ribbon family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338572

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000395007	0.749	Zinc finger protein 746
2	9606.ENSP00000477841	0.721	Zinc finger protein 282
3	9606.ENSP00000420418	0.688	Zinc finger protein 398
4	9606.ENSP00000305260	0.682	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
5	9606.ENSP00000306095	0.681	Olfactory receptor 10H2
6	9606.ENSP00000247930	0.671	Zinc finger protein 777
7	9606.ENSP00000304762	0.654	Sperm acrosome associated 5B
8	9606.ENSP00000305847	0.654	Sperm acrosome associated 5
9	9606.ENSP00000320188	0.635	Zinc finger protein 579
10	9606.ENSP00000445418	0.629	Protein FAM90A1
11	9606.ENSP00000362110	0.611	Splicing factor 3A subunit 3
12	9606.ENSP00000392335	0.596	Putative zinc finger protein 487
13	9606.ENSP00000369853	0.544	C2 calcium dependent domain containing 2
14	9606.ENSP00000376608	0.536	Glycosyltransferase-like domain-containing protein 1
15	9606.ENSP00000296121	0.521	Uncharacterized protein KIAA1143
16	9606.ENSP00000410890	0.519	Protein ZNF783
17	9606.ENSP00000257312	0.508	Zinc finger protein DZIP1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.994	identical protein binding
GO:0000981	0.966	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.710	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003676	0.612	nucleic acid binding
GO:0003677	0.597	DNA binding
GO:0043565	0.399	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0019222	0.985	regulation of metabolic process
GO:0060255	0.980	regulation of macromolecule metabolic process
GO:0009987	0.975	cellular process
GO:0080090	0.957	regulation of primary metabolic process
GO:0051171	0.957	regulation of nitrogen compound metabolic process
GO:0031323	0.929	regulation of cellular metabolic process
GO:0010468	0.922	regulation of gene expression
GO:0019219	0.919	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.905	regulation of macromolecule biosynthetic process
GO:0031326	0.905	regulation of cellular biosynthetic process
GO:0051252	0.905	regulation of RNA metabolic process
GO:0006355	0.902	regulation of DNA-templated transcription
GO:0032501	0.846	multicellular organismal process
GO:0032502	0.785	developmental process
GO:0071840	0.775	cellular component organization or biogenesis
GO:0048856	0.771	anatomical structure development
GO:0016043	0.764	cellular component organization
GO:0007275	0.723	multicellular organism development
GO:0050896	0.721	response to stimulus
GO:0006357	0.693	regulation of transcription by RNA polymerase II
GO:0048518	0.653	positive regulation of biological process
GO:0045893	0.606	positive regulation of DNA-templated transcription
GO:0048731	0.597	system development
GO:0007610	0.561	behavior
GO:0030182	0.533	neuron differentiation
GO:0090659	0.503	walking behavior
GO:0042221	0.448	response to chemical
GO:0048468	0.445	cell development
GO:0050905	0.420	neuromuscular process
GO:0050885	0.402	neuromuscular process controlling balance
GO:0006950	0.354	response to stress
GO:0031175	0.344	neuron projection development
GO:0045944	0.309	positive regulation of transcription by RNA polymerase II
GO:0048523	0.302	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0005737	0.649	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]