StarFunc result for job id Q9UDW1

User Input

>input (63 residues)
MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKY
ENK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UDW1	1.000	1.000	4.361E-8	63	1.000	1.000	Q9UDW1.pdb.gz	QCR9_HUMAN Cytochrome b-c1 complex subunit 9 OS=Homo sapiens OX=9606 GN=UQCR10 PE=1 SV=3
2	PDB:5xteD	0.896	0.909	1.978E-7	62	0.984	1.000	5xteD.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
3	AFDB:Q8R1I1	0.994	0.979	8.771E-7	64	0.841	0.828	Q8R1I1.pdb.gz	QCR9_MOUSE Cytochrome b-c1 complex subunit 9 OS=Mus musculus OX=10090 GN=Uqcr10 PE=1 SV=1
4	PDB:7o37J	0.913	0.957	5.136E-6	60	0.810	0.850	7o37J.pdb.gz	Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
5	AFDB:O74433	0.834	0.787	1.535E-2	67	0.286	0.269	O74433.pdb.gz	QCR9_SCHPO Cytochrome b-c1 complex subunit 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=qcr9 PE=3 SV=2
6	AFDB:P22289	0.830	0.794	3.521E-2	66	0.317	0.303	P22289.pdb.gz	QCR9_YEAST Cytochrome b-c1 complex subunit 9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=QCR9 PE=1 SV=2
7	AFDB:A0A1D8PLP3	0.749	0.728	9.175E-2	65	0.286	0.277	A0A1D8PLP3.pdb.gz	A0A1D8PLP3_CANAL Complex III subunit 9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=QCR9 PE=1 SV=1
8	AFDB:Q9LXJ2	0.743	0.656	2.717E-1	72	0.270	0.236	Q9LXJ2.pdb.gz	QCR9_ARATH Cytochrome b-c1 complex subunit 9, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=QCR9 PE=1 SV=1
9	PDB:7rjaI	0.493	0.718	8.955E-1	39	0.206	0.333	7rjaI.pdb.gz	Rieske head domain dynamics and indazole-derivative inhibition of Candida albicans complex III.
10	AFDB:Q9S7S4	0.468	0.076	8.014	541	0.111	0.013	Q9S7S4.pdb.gz	Q9S7S4_ARATH Transmembrane protein, putative (DUF247) OS=Arabidopsis thaliana OX=3702 GN=F11C1_10 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UDW1	8.11e-42	131	63	1.000	1.000	QCR9_HUMAN Cytochrome b-c1 complex subunit 9 OS=Homo sapiens OX=9606 GN=UQCR10 PE=1 SV=3
2	Q8R1I1	2.03e-36	118	64	0.841	0.828	QCR9_MOUSE Cytochrome b-c1 complex subunit 9 OS=Mus musculus OX=10090 GN=Uqcr10 PE=1 SV=1
3	O74433	7.77e-08	45.8	67	0.317	0.299	QCR9_SCHPO Cytochrome b-c1 complex subunit 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=qcr9 PE=3 SV=2
4	P22289	9.25e-08	45.8	66	0.317	0.303	QCR9_YEAST Cytochrome b-c1 complex subunit 9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=QCR9 PE=1 SV=2
5	Q9LXJ2	1.31e-04	37.7	72	0.286	0.250	QCR9_ARATH Cytochrome b-c1 complex subunit 9, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=QCR9 PE=1 SV=1
6	P25293	4.7	26.9	417	0.254	0.038	NAP1_YEAST Nucleosome assembly protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAP1 PE=1 SV=2
7	Q9FUZ2	8.1	26.2	273	0.206	0.048	DEF1B_ARATH Peptide deformylase 1B, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PDF1B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05365 UCR_UQCRX_QCR9	2.9e-22	89.6	Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332887

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000203407	0.999	Cytochrome b-c1 complex subunit 1, mitochondrial
2	9606.ENSP00000268379	0.999	Cytochrome b-c1 complex subunit 2, mitochondrial
3	9606.ENSP00000306397	0.999	Cytochrome b-c1 complex subunit Rieske, mitochondrial
4	9606.ENSP00000309565	0.999	Cytochrome b-c1 complex subunit 6, mitochondrial
5	9606.ENSP00000317159	0.999	Cytochrome c1, heme protein, mitochondrial
6	9606.ENSP00000367939	0.999	Cytochrome b-c1 complex subunit 8
7	9606.ENSP00000430494	0.999	Cytochrome b-c1 complex subunit 7
8	9606.ENSP00000467262	0.999	Cytochrome b-c1 complex subunit 10
9	9606.ENSP00000266544	0.998	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
10	9606.ENSP00000317780	0.998	Cytochrome c oxidase subunit 5A, mitochondrial
11	9606.ENSP00000354554	0.996	Cytochrome b
12	9606.ENSP00000418842	0.996	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
13	9606.ENSP00000307786	0.995	Cytochrome c
14	9606.ENSP00000246554	0.994	Cytochrome c oxidase subunit 6B1
15	9606.ENSP00000425759	0.994	Cytochrome c oxidase subunit 7C, mitochondrial
16	9606.ENSP00000258424	0.992	Cytochrome c oxidase subunit 5B, mitochondrial
17	9606.ENSP00000389160	0.992	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11
18	9606.ENSP00000457513	0.992	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
19	9606.ENSP00000485401	0.991	May be a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1.
20	9606.ENSP00000268668	0.990	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.476	catalytic activity
GO:0022857	0.377	transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0044237	0.993	cellular metabolic process
GO:0007005	0.982	mitochondrion organization
GO:0006091	0.975	generation of precursor metabolites and energy
GO:0065003	0.963	protein-containing complex assembly
GO:0045333	0.936	cellular respiration
GO:0033108	0.889	mitochondrial respiratory chain complex assembly
GO:0009060	0.813	aerobic respiration
GO:0006119	0.571	oxidative phosphorylation
GO:0006122	0.421	mitochondrial electron transport, ubiquinol to cytochrome c

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098800	0.999	inner mitochondrial membrane protein complex
GO:1902494	0.998	catalytic complex
GO:0005746	0.995	mitochondrial respirasome
GO:0070069	0.953	cytochrome complex
GO:0098803	0.947	respiratory chain complex
GO:1990204	0.939	oxidoreductase complex
GO:1902495	0.935	transmembrane transporter complex
GO:0045275	0.829	respiratory chain complex III
GO:0005750	0.801	mitochondrial respiratory chain complex III

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]