StarFunc result for job id Q9UDX3

User Input

>input (406 residues)
MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQKSEDMLRRHM
EFRKQQDLDNIVTWQPPEVIQLYDSGGLCGYDYEGCPVYFNIIGSLDPKGLLLSASKQDM
IRKRIKVCELLLHECELQTQKLGRKIEMALMVFDMEGLSLKHLWKPAVEVYQQFFSILEA
NYPETLKNLIVIRAPKLFPVAFNLVKSFMSEETRRKIVILGDNWKQELTKFISPDQLPVE
FGGTMTDPDGNPKCLTKINYGGEVPKSYYLCEQVRLQYEHTRSVGRGSSLQVENEILFPG
CVLRWQFASDGGDIGFGVFLKTKMGEQQSAREMTEVLPSQRYNAHMVPEDGSLTCLQAGV
YVLRFDNTYSRMHAKKLSYTVEVLLPDKASEETLQSLKAMRPSPTQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UDX3	1.000	1.000	3.803E-88	406	1.000	1.000	Q9UDX3.pdb.gz	S14L4_HUMAN SEC14-like protein 4 OS=Homo sapiens OX=9606 GN=SEC14L4 PE=1 SV=1
2	PDB:4tlgA	0.950	0.973	1.787E-78	396	0.968	0.992	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
3	AFDB:A0A024R1I5	0.975	0.982	1.378E-67	403	0.697	0.702	A0A024R1I5.pdb.gz
4	PDB:1olmE	0.958	0.980	3.057E-66	397	0.687	0.703	1olmE.pdb.gz	Supernatant Protein Factor in Complex with Rrr-Alpha-Tocopherylquinone: A Link between Oxidized Vitamin E and Cholesterol Biosynthesis
5	AFDB:Q9UDX4	0.959	0.973	8.453E-66	400	0.685	0.695	Q9UDX4.pdb.gz	S14L3_HUMAN SEC14-like protein 3 OS=Homo sapiens OX=9606 GN=SEC14L3 PE=1 SV=1
6	PDB:4uybA	0.957	0.969	2.693E-65	401	0.687	0.696	4uybA.pdb.gz
7	AFDB:A2BIR0	0.941	0.967	2.537E-63	395	0.579	0.595	A2BIR0.pdb.gz	A2BIR0_DANRE SEC14-like lipid-binding 8 OS=Danio rerio OX=7955 GN=si:ch211-89f7.1 PE=4 SV=2
8	AFDB:O43304	0.733	0.455	3.203E-37	696	0.315	0.184	O43304.pdb.gz	S14L5_HUMAN SEC14-like protein 5 OS=Homo sapiens OX=9606 GN=SEC14L5 PE=1 SV=3
9	AFDB:O17907	0.616	0.651	2.230E-36	383	0.278	0.295	O17907.pdb.gz	CTG1_CAEEL Protein ctg-1 OS=Caenorhabditis elegans OX=6239 GN=ctg-1 PE=2 SV=2
10	AFDB:Q92503	0.709	0.429	8.131E-36	715	0.310	0.176	Q92503.pdb.gz	S14L1_HUMAN SEC14-like protein 1 OS=Homo sapiens OX=9606 GN=SEC14L1 PE=1 SV=2
11	AFDB:Q9VMD6	0.608	0.387	4.105E-32	659	0.264	0.162	Q9VMD6.pdb.gz	RETM_DROME Protein real-time OS=Drosophila melanogaster OX=7227 GN=retm PE=1 SV=2
12	AFDB:Q22824	0.573	0.606	2.239E-30	383	0.214	0.227	Q22824.pdb.gz	Q22824_CAEEL CRAL-TRIO domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cgr-1 PE=1 SV=3
13	AFDB:Q9SCU1	0.510	0.506	1.260E-25	409	0.214	0.213	Q9SCU1.pdb.gz	PATL6_ARATH Patellin-6 OS=Arabidopsis thaliana OX=3702 GN=PATL6 PE=2 SV=1
14	PDB:3b7nA	0.551	0.721	5.359E-18	307	0.192	0.254	3b7nA.pdb.gz	Functional anatomy of phospholipid binding and regulation of phosphoinositide homeostasis by proteins of the sec14 superfamily
15	PDB:6f0eA	0.535	0.712	1.638E-17	300	0.175	0.237	6f0eA.pdb.gz	Target Identification and Mechanism of Action of Picolinamide and Benzamide Chemotypes with Antifungal Properties.
16	PDB:3w68C	0.402	0.598	1.462E-11	252	0.150	0.242	3w68C.pdb.gz	Impaired alpha-TTP-PIPs interaction underlies familial vitamin E deficiency
17	PDB:1oizA	0.402	0.567	2.341E-11	265	0.167	0.257	1oizA.pdb.gz	The Molecular Basis of Vitamin E Retention: Structure of Human Alpha-Tocopherol Transfer Protein
18	PDB:7wvtA	0.432	0.478	6.361E-11	364	0.148	0.165	7wvtA.pdb.gz	Structural basis of ligand recognition and transport by Sfh2, a yeast phosphatidylinositol transfer protein of the Sec14 superfamily.
19	PDB:4cizA	0.433	0.586	2.437E-9	284	0.133	0.190	4cizA.pdb.gz	Human Cellular Retinaldehyde-Binding Protein Has Secondary Thermal 9-Cis-Retinal Isomerase Activity.
20	PDB:4fmmB	0.407	0.499	5.502E-8	325	0.111	0.138	4fmmB.pdb.gz	Dimeric Sfh3 has structural changes in its binding pocket that are associated with a dimer-monomer state transformation induced by substrate binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2BIR0	0.0	523	395	0.579	0.595	A2BIR0_DANRE SEC14-like lipid-binding 8 OS=Danio rerio OX=7955 GN=si:ch211-89f7.1 PE=4 SV=2
2	O76054	0.0	625	403	0.697	0.702	S14L2_HUMAN SEC14-like protein 2 OS=Homo sapiens OX=9606 GN=SEC14L2 PE=1 SV=1
3	Q99MS0	0.0	625	403	0.702	0.707	S14L2_RAT SEC14-like protein 2 OS=Rattus norvegicus OX=10116 GN=Sec14l2 PE=1 SV=1
4	Q9UDX3	0.0	844	406	1.000	1.000	S14L4_HUMAN SEC14-like protein 4 OS=Homo sapiens OX=9606 GN=SEC14L4 PE=1 SV=1
5	Q9UDX4	0.0	616	400	0.685	0.695	S14L3_HUMAN SEC14-like protein 3 OS=Homo sapiens OX=9606 GN=SEC14L3 PE=1 SV=1
6	B3KRD8	7.43e-173	487	329	0.544	0.672	B3KRD8_HUMAN SEC14 like lipid binding 2 OS=Homo sapiens OX=9606 GN=SEC14L2 PE=1 SV=1
7	C9JZI9	4.96e-105	310	203	0.337	0.675	C9JZI9_HUMAN SEC14 like lipid binding 2 (Fragment) OS=Homo sapiens OX=9606 GN=SEC14L2 PE=1 SV=1
8	O17907	9.93e-58	195	383	0.276	0.292	CTG1_CAEEL Protein ctg-1 OS=Caenorhabditis elegans OX=6239 GN=ctg-1 PE=2 SV=2
9	O43304	1.76e-54	193	696	0.288	0.168	S14L5_HUMAN SEC14-like protein 5 OS=Homo sapiens OX=9606 GN=SEC14L5 PE=1 SV=3
10	Q92503	8.47e-54	192	715	0.273	0.155	S14L1_HUMAN SEC14-like protein 1 OS=Homo sapiens OX=9606 GN=SEC14L1 PE=1 SV=2
11	Q9VMD6	2.70e-36	142	659	0.204	0.126	RETM_DROME Protein real-time OS=Drosophila melanogaster OX=7227 GN=retm PE=1 SV=2
12	Q10137	5.19e-29	116	286	0.202	0.287	SEC14_SCHPO Sec14 cytosolic factor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec14 PE=4 SV=1
13	Q22824	1.83e-28	117	383	0.214	0.227	Q22824_CAEEL CRAL-TRIO domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cgr-1 PE=1 SV=3
14	F4JLE5	4.16e-27	115	554	0.209	0.153	SFH1_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH1 OS=Arabidopsis thaliana OX=3702 GN=SFH1 PE=2 SV=1
15	P46250	6.31e-27	111	301	0.214	0.289	SEC14_CANAL SEC14 cytosolic factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SEC14 PE=2 SV=1
16	Q93ZE9	1.36e-26	113	548	0.192	0.142	SFH3_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH3 OS=Arabidopsis thaliana OX=3702 GN=SFH3 PE=2 SV=1
17	F4JVA9	1.47e-26	113	554	0.187	0.137	SFH2_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH2 OS=Arabidopsis thaliana OX=3702 GN=SFH2 PE=3 SV=1
18	P24280	3.70e-25	106	304	0.187	0.250	SEC14_YEAST SEC14 cytosolic factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC14 PE=1 SV=3
19	F4HZ25	5.13e-25	109	668	0.192	0.117	F4HZ25_ARATH Sec14p-like phosphatidylinositol transfer family protein OS=Arabidopsis thaliana OX=3702 GN=At1g75370 PE=1 SV=1
20	P33324	9.39e-25	105	310	0.195	0.255	YKJ1_YEAST CRAL-TRIO domain-containing protein YKL091C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YKL091C PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00650 CRAL_TRIO	1e-36	137.6	CRAL/TRIO domain
2	PF13716 CRAL_TRIO_2	0.00062	31.5	Divergent CRAL/TRIO domain
3	PF03765 CRAL_TRIO_N	0.33	22.5	CRAL/TRIO, N-terminal domain
4	PF13897 GOLD_2	1.9e-07	43.1	Golgi-dynamics membrane-trafficking
5	PF03334 PhaG_MnhG_YufB	47	15.6	Na+/H+ antiporter subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255858

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359376	0.531	Solute carrier family 17 member 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.989	regulation of biological process
GO:0048518	0.891	positive regulation of biological process
GO:0009987	0.871	cellular process
GO:0050794	0.865	regulation of cellular process
GO:0019216	0.775	regulation of lipid metabolic process
GO:0019218	0.727	regulation of steroid metabolic process
GO:0046890	0.673	regulation of lipid biosynthetic process
GO:0071704	0.412	organic substance metabolic process
GO:0009893	0.400	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0043227	0.996	membrane-bounded organelle
GO:0043231	0.959	intracellular membrane-bounded organelle
GO:0005829	0.948	cytosol
GO:0070013	0.916	intracellular organelle lumen
GO:0016020	0.907	membrane
GO:0005634	0.894	nucleus
GO:0031981	0.872	nuclear lumen
GO:0005654	0.864	nucleoplasm
GO:0005576	0.416	extracellular region
GO:0031982	0.413	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]