StarFunc result for job id Q9UDY2

User Input

>input (1190 residues)
MPVRGDRGFPPRRELSGWLRAPGMEELIWEQYTVTLQKDSKRGFGIAVSGGRDNPHFENG
ETSIVISDVLPGGPADGLLQENDRVVMVNGTPMEDVLHSFAVQQLRKSGKVAAIVVKRPR
KVQVAALQASPPLDQDDRAFEVMDEFDGRSFRSGYSERSRLNSHGGRSRSWEDSPERGRP
HERARSRERDLSRDRSRGRSLERGLDQDHARTRDRSRGRSLERGLDHDFGPSRDRDRDRS
RGRSIDQDYERAYHRAYDPDYERAYSPEYRRGARHDARSRGPRSRSREHPHSRSPSPEPR
GRPGPIGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTEN
MSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERR
HQYSDYDYHSSSEKLKERPSSREDTPSRLSRMGATPTPFKSTGDIAGTVVPETNKEPRYQ
EDPPAPQPKAAPRTFLRPSPEDEAIYGPNTKMVRFKKGDSVGLRLAGGNDVGIFVAGIQE
GTSAEQEGLQEGDQILKVNTQDFRGLVREDAVLYLLEIPKGEMVTILAQSRADVYRDILA
CGRGDSFFIRSHFECEKETPQSLAFTRGEVFRVVDTLYDGKLGNWLAVRIGNELEKGLIP
NKSRAEQMASVQNAQRDNAGDRADFWRMRGQRSGVKKNLRKSREDLTAVVSVSTKFPAYE
RVLLREAGFKRPVVLFGPIADIAMEKLANELPDWFQTAKTEPKDAGSEKSTGVVRLNTVR
QIIEQDKHALLDVTPKAVDLLNYTQWFPIVIFFNPDSRQGVKTMRQRLNPTSNKSSRKLF
DQANKLKKTCAHLFTATINLNSANDSWFGSLKDTIQHQQGEAVWVSEGKMEGMDDDPEDR
MSYLTAMGADYLSCDSRLISDFEDTDGEGGAYTDNELDEPAEEPLVSSITRSSEPVQHEE
SIRKPSPEPRAQMRRAASSDQLRDNSPPPAFKPEPPKAKTQNKEESYDFSKSYEYKSNPS
AVAGNETPGASTKGYPPPVAAKPTFGRSILKPSTPIPPQEGEEVGESSEEQDNAPKSVLG
KVKIFEKMDHKARLQRMQELQEAQNARIEIAQKHPDIYAVPIKTHKPDPGTPQHTSSRPP
EPQKAPSRPYQDTRGSYGSDAEEEEYRQQLSEHSKRGYYGQSARYRDTEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UDY2	1.000	1.000	0.000	1190	1.000	1.000	Q9UDY2.pdb.gz	ZO2_HUMAN Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2 PE=1 SV=2
2	AFDB:A0A1D5NS76	0.319	0.199	1.341E-93	2005	0.441	0.262	A0A1D5NS76.pdb.gz
3	AFDB:A0A2R8QMK9	0.307	0.220	2.203E-93	1689	0.429	0.302	A0A2R8QMK9.pdb.gz
4	AFDB:P39447	0.336	0.238	2.747E-93	1745	0.444	0.303	P39447.pdb.gz	ZO1_MOUSE Tight junction protein ZO-1 OS=Mus musculus OX=10090 GN=Tjp1 PE=1 SV=2
5	PDB:2xkxA	0.166	0.246	2.362E-31	721	0.151	0.250	2xkxA.pdb.gz
6	AFDB:Q5TCQ9	0.104	0.089	9.417E-15	1481	0.137	0.110	Q5TCQ9.pdb.gz	MAGI3_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAGI3 PE=1 SV=3
7	PDB:7p73A	0.082	0.227	4.034E-8	420	0.024	0.069	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
8	PDB:7mixC	0.110	0.284	4.263E-8	324	0.040	0.148	7mixC.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
9	AFDB:Q9ULL8	0.079	0.065	6.309E-8	1493	0.134	0.106	Q9ULL8.pdb.gz	SHRM4_HUMAN Protein Shroom4 OS=Homo sapiens OX=9606 GN=SHROOM4 PE=1 SV=3
10	AFDB:Q9VUE8	0.072	0.034	1.611E-7	2637	0.085	0.038	Q9VUE8.pdb.gz	Q9VUE8_DROME Big bang, isoform C OS=Drosophila melanogaster OX=7227 GN=bbg PE=2 SV=2
11	AFDB:Q9W283	0.070	0.063	2.370E-7	1329	0.089	0.080	Q9W283.pdb.gz	Q9W283_DROME Arc, isoform A OS=Drosophila melanogaster OX=7227 GN=a PE=2 SV=2
12	PDB:7pc3A	0.073	0.212	6.016E-7	405	0.025	0.074	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
13	AFDB:Q9JLU4	0.081	0.057	8.904E-7	1740	0.144	0.098	Q9JLU4.pdb.gz	SHAN3_RAT SH3 and multiple ankyrin repeat domains protein 3 OS=Rattus norvegicus OX=10116 GN=Shank3 PE=1 SV=3
14	AFDB:A2ALU4	0.075	0.061	1.463E-6	1481	0.162	0.130	A2ALU4.pdb.gz	SHRM2_MOUSE Protein Shroom2 OS=Mus musculus OX=10090 GN=Shroom2 PE=1 SV=1
15	PDB:6t36A	0.070	0.844	1.813E-6	93	0.020	0.258	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
16	PDB:7qqmA	0.074	0.206	4.146E-6	413	0.023	0.065	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
17	PDB:4f4jA	0.108	0.558	1.320E-5	189	0.027	0.169	4f4jA.pdb.gz
18	PDB:7qqnC	0.064	0.179	1.739E-5	414	0.021	0.060	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:7p70A	0.067	0.195	1.838E-5	407	0.024	0.069	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
20	PDB:7pc5A	0.070	0.198	2.857E-5	405	0.028	0.081	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087X0K9	0.0	746	1768	0.345	0.232	A0A087X0K9_HUMAN Tight junction protein 1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=2
2	A0A0G2K2P5	0.0	743	1765	0.392	0.265	ZO1_RAT Tight junction protein ZO-1 OS=Rattus norvegicus OX=10116 GN=Tjp1 PE=1 SV=1
3	A0A8I6ALD4	0.0	1989	1239	0.850	0.817	A0A8I6ALD4_RAT Tight junction protein 2 OS=Rattus norvegicus OX=10116 GN=Tjp2 PE=1 SV=1
4	A0A8I6AP88	0.0	1924	1129	0.819	0.864	A0A8I6AP88_RAT Tight junction protein 2 OS=Rattus norvegicus OX=10116 GN=Tjp2 PE=1 SV=1
5	A0A8I6GLX8	0.0	2024	1189	0.866	0.866	A0A8I6GLX8_RAT Tight junction protein 2 OS=Rattus norvegicus OX=10116 GN=Tjp2 PE=4 SV=1
6	A0A8J8Y4W9	0.0	1985	1166	0.849	0.866	A0A8J8Y4W9_RAT Tight junction protein 2 OS=Rattus norvegicus OX=10116 GN=Tjp2 PE=1 SV=1
7	F1M4A0	0.0	743	1725	0.392	0.271	F1M4A0_RAT Tight junction protein 1 OS=Rattus norvegicus OX=10116 GN=Tjp1 PE=1 SV=3
8	G3V1L9	0.0	746	1861	0.345	0.221	G3V1L9_HUMAN Tight junction protein 1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=2
9	G5E9E7	0.0	744	1692	0.344	0.242	G5E9E7_HUMAN Tight junction protein 1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=1
10	O95049	0.0	564	919	0.267	0.346	ZO3_HUMAN Tight junction protein ZO-3 OS=Homo sapiens OX=9606 GN=TJP3 PE=1 SV=3
11	O97758	0.0	752	1769	0.362	0.244	ZO1_CANLF Tight junction protein ZO-1 OS=Canis lupus familiaris OX=9615 GN=TJP1 PE=1 SV=1
12	P39447	0.0	751	1745	0.361	0.246	ZO1_MOUSE Tight junction protein ZO-1 OS=Mus musculus OX=10090 GN=Tjp1 PE=1 SV=2
13	P70625	0.0	1450	813	0.603	0.882	P70625_RAT Zonula occludens 2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=ZO-2 PE=2 SV=2
14	Q07157	0.0	747	1748	0.345	0.235	ZO1_HUMAN Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=3
15	Q3ZB99	0.0	1978	1164	0.847	0.866	Q3ZB99_RAT Tight junction protein 2 OS=Rattus norvegicus OX=10116 GN=Tjp2 PE=1 SV=1
16	Q95168	0.0	2023	1174	0.885	0.897	ZO2_CANLF Tight junction protein ZO-2 OS=Canis lupus familiaris OX=9615 GN=TJP2 PE=1 SV=1
17	Q9UDY2	0.0	2440	1190	1.000	1.000	ZO2_HUMAN Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2 PE=1 SV=2
18	Q9Z0U1	0.0	1914	1167	0.842	0.859	ZO2_MOUSE Tight junction protein ZO-2 OS=Mus musculus OX=10090 GN=Tjp2 PE=1 SV=2
19	D3Z8G7	1.40e-179	553	906	0.269	0.353	D3Z8G7_RAT Tight junction protein 3 OS=Rattus norvegicus OX=10116 GN=Tjp3 PE=1 SV=3
20	Q9QXY1	2.14e-172	534	905	0.263	0.346	ZO3_MOUSE Tight junction protein ZO-3 OS=Mus musculus OX=10090 GN=Tjp3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19805 DUF6288	5.7	17.6	Family of unknown function (DUF6288)
2	PF00625 Guanylate_kin	4.5e-08	44.5	Guanylate kinase
3	PF00595 PDZ	8.9e-42	152.7	PDZ domain
4	PF13180 PDZ_2	2.5e-09	48.7	PDZ domain
5	PF17820 PDZ_6	3.5e-20	83.0	PDZ domain
6	PF02163 Peptidase_M50	4.6e-08	44.3	Peptidase family M50
7	PF00018 SH3_1	1.6	19.7	SH3 domain
8	PF07653 SH3_2	0.0001	33.3	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000438262

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347379	0.997	Occludin
2	9606.ENSP00000479618	0.988	Myc proto-oncogene protein
3	9606.ENSP00000282561	0.980	Gap junction alpha-1 protein
4	9606.ENSP00000281537	0.978	Tight junction protein ZO-1
5	9606.ENSP00000357005	0.978	Junctional adhesion molecule A
6	9606.ENSP00000325240	0.967	LIM and SH3 domain protein 1
7	9606.ENSP00000478927	0.966	Transcriptional coactivator YAP1
8	9606.ENSP00000271636	0.959	Cingulin
9	9606.ENSP00000360266	0.952	Transcription factor AP-1
10	9606.ENSP00000375960	0.951	Afadin
11	9606.ENSP00000467423	0.940	Scaffold attachment factor B1
12	9606.ENSP00000311032	0.918	Caspase-3
13	9606.ENSP00000264431	0.910	Rap guanine nucleotide exchange factor 2
14	9606.ENSP00000351490	0.900	Protein max
15	9606.ENSP00000364885	0.900	Zinc finger and BTB domain-containing protein 17
16	9606.ENSP00000357836	0.885	Sorting nexin-27
17	9606.ENSP00000295522	0.880	Claudin-1
18	9606.ENSP00000263207	0.870	Armadillo repeat protein deleted in velo-cardio-facial syndrome
19	9606.ENSP00000419465	0.858	WW domain-containing transcription regulator protein 1
20	9606.ENSP00000385477	0.840	Claudin-5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0045296	0.667	cadherin binding
GO:0019899	0.551	enzyme binding
GO:0004385	0.542	guanylate kinase activity
GO:0019904	0.522	protein domain specific binding
GO:1990782	0.506	protein tyrosine kinase binding
GO:0030674	0.425	protein-macromolecule adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.979	response to stimulus
GO:0042221	0.935	response to chemical
GO:0009987	0.879	cellular process
GO:0010033	0.850	response to organic substance
GO:0065007	0.754	biological regulation
GO:0050794	0.628	regulation of cellular process
GO:0032501	0.574	multicellular organismal process
GO:0016043	0.377	cellular component organization
GO:0032502	0.328	developmental process
GO:0048856	0.322	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070160	0.998	tight junction
GO:0043296	0.993	apical junction complex
GO:0005886	0.976	plasma membrane
GO:0005923	0.956	bicellular tight junction
GO:0005622	0.951	intracellular anatomical structure
GO:0043226	0.873	organelle
GO:0043229	0.822	intracellular organelle
GO:0043227	0.809	membrane-bounded organelle
GO:0005737	0.752	cytoplasm
GO:0043231	0.722	intracellular membrane-bounded organelle
GO:0005634	0.652	nucleus
GO:0044291	0.386	cell-cell contact zone

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:20780	0.542	ATP + GMP = ADP + GDP
EC:2.7.4.8	0.542	guanylate kinase.

[back to server]