StarFunc result for job id Q9UDY6

User Input

>input (481 residues)
MASAASVTSLADEVNCPICQGTLREPVTIDCGHNFCRACLTRYCEIPGPDLEESPTCPLC
KEPFRPGSFRPNWQLANVVENIERLQLVSTLGLGEEDVCQEHGEKIYFFCEDDEMQLCVV
CREAGEHATHTMRFLEDAAAPYREQIHKCLKCLRKEREEIQEIQSRENKRMQVLLTQVST
KRQQVISEFAHLRKFLEEQQSILLAQLESQDGDILRQRDEFDLLVAGEICRFSALIEELE
EKNERPARELLTDIRSTLIRCETRKCRKPVAVSPELGQRIRDFPQQALPLQREMKMFLEK
LCFELDYEPAHISLDPQTSHPKLLLSEDHQRAQFSYKWQNSPDNPQRFDRATCVLAHTGI
TGGRHTWVVSIDLAHGGSCTVGVVSEDVQRKGELRLRPEEGVWAVRLAWGFVSALGSFPT
RLTLKEQPRQVRVSLDYEVGWVTFTNAVTREPIYTFTASFTRKVIPFFGLWGRGSSFSLS
S

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UDY6	1.000	1.000	3.940E-92	481	1.000	1.000	Q9UDY6.pdb.gz	TRI10_HUMAN Tripartite motif-containing protein 10 OS=Homo sapiens OX=9606 GN=TRIM10 PE=1 SV=3
2	AFDB:Q9WUH5	0.739	0.728	1.912E-78	489	0.832	0.818	Q9WUH5.pdb.gz	TRI10_MOUSE Tripartite motif-containing protein 10 OS=Mus musculus OX=10090 GN=Trim10 PE=2 SV=2
3	AFDB:Q12899	0.383	0.345	2.505E-49	539	0.403	0.360	Q12899.pdb.gz	TRI26_HUMAN Tripartite motif-containing protein 26 OS=Homo sapiens OX=9606 GN=TRIM26 PE=1 SV=1
4	AFDB:Q99PN3	0.375	0.334	5.887E-48	545	0.397	0.350	Q99PN3.pdb.gz	TRI26_MOUSE Tripartite motif-containing protein 26 OS=Mus musculus OX=10090 GN=Trim26 PE=2 SV=3
5	AFDB:Q923T7	0.438	0.419	9.258E-47	510	0.356	0.335	Q923T7.pdb.gz	TRIM7_MOUSE E3 ubiquitin-protein ligase TRIM7 OS=Mus musculus OX=10090 GN=Trim7 PE=2 SV=2
6	AFDB:Q9C019	0.363	0.373	1.644E-46	465	0.418	0.432	Q9C019.pdb.gz	TRI15_HUMAN E3 ubiquitin-protein ligase TRIM15 OS=Homo sapiens OX=9606 GN=TRIM15 PE=1 SV=1
7	AFDB:Q9C029	0.432	0.413	1.741E-46	511	0.353	0.333	Q9C029.pdb.gz	TRIM7_HUMAN E3 ubiquitin-protein ligase TRIM7 OS=Homo sapiens OX=9606 GN=TRIM7 PE=1 SV=2
8	AFDB:Q5NCC9	0.405	0.402	1.707E-43	485	0.326	0.324	Q5NCC9.pdb.gz	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
9	AFDB:A0A024RCR1	0.363	0.358	2.861E-43	488	0.362	0.357	A0A024RCR1.pdb.gz
10	AFDB:A0A1U9X8R9	0.398	0.379	5.380E-43	513	0.349	0.327	A0A1U9X8R9.pdb.gz	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
11	PDB:7y4sA	0.353	0.487	8.969E-21	343	0.175	0.245	7y4sA.pdb.gz
12	PDB:4b3nA	0.301	0.261	1.521E-13	557	0.094	0.081	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
13	PDB:4tn3B	0.311	0.400	2.452E-7	362	0.094	0.124	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
14	PDB:7ccbA	0.250	0.664	3.267E-7	164	0.040	0.116	7ccbA.pdb.gz
15	PDB:7z36B	0.227	0.243	5.172E-7	446	0.129	0.139	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
16	PDB:7nscA	0.276	0.460	2.436E-6	276	0.060	0.105	7nscA.pdb.gz
17	PDB:6swy1	0.237	0.213	6.846E-6	542	0.064	0.057	6swy1.pdb.gz
18	PDB:1umzA	0.204	0.334	6.064E-5	267	0.046	0.082	1umzA.pdb.gz	Crystal Structures of a Poplar Xyloglucan Endotransglycosylase Reveal Details of Transglycosylation Acceptor Binding
19	PDB:7nsba	0.227	0.195	1.140E-4	568	0.081	0.069	7nsba.pdb.gz
20	PDB:7m6aA	0.219	0.028	5.371E-4	4306	0.050	0.006	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UDY6	0.0	989	481	1.000	1.000	TRI10_HUMAN Tripartite motif-containing protein 10 OS=Homo sapiens OX=9606 GN=TRIM10 PE=1 SV=3
2	Q9WUH5	0.0	827	489	0.842	0.828	TRI10_MOUSE Tripartite motif-containing protein 10 OS=Mus musculus OX=10090 GN=Trim10 PE=2 SV=2
3	Q9C019	2.05e-124	372	465	0.426	0.441	TRI15_HUMAN E3 ubiquitin-protein ligase TRIM15 OS=Homo sapiens OX=9606 GN=TRIM15 PE=1 SV=1
4	A0A024RCP5	6.07e-92	290	518	0.372	0.346	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
5	Q9HCM9	6.07e-92	290	518	0.372	0.346	TRI39_HUMAN E3 ubiquitin-protein ligase TRIM39 OS=Homo sapiens OX=9606 GN=TRIM39 PE=1 SV=2
6	Q6AZZ1	4.33e-88	280	485	0.345	0.342	TRI68_HUMAN E3 ubiquitin-protein ligase TRIM68 OS=Homo sapiens OX=9606 GN=TRIM68 PE=1 SV=1
7	Q923T7	3.28e-86	275	510	0.353	0.333	TRIM7_MOUSE E3 ubiquitin-protein ligase TRIM7 OS=Mus musculus OX=10090 GN=Trim7 PE=2 SV=2
8	A0A1U9X8R9	9.70e-85	271	513	0.345	0.324	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
9	P14373	9.70e-85	271	513	0.345	0.324	TRI27_HUMAN Zinc finger protein RFP OS=Homo sapiens OX=9606 GN=TRIM27 PE=1 SV=1
10	Q62158	1.19e-84	271	513	0.351	0.329	TRI27_MOUSE Zinc finger protein RFP OS=Mus musculus OX=10090 GN=Trim27 PE=1 SV=2
11	Q9C029	1.29e-82	266	511	0.353	0.333	TRIM7_HUMAN E3 ubiquitin-protein ligase TRIM7 OS=Homo sapiens OX=9606 GN=TRIM7 PE=1 SV=2
12	Q12899	1.05e-80	262	539	0.297	0.265	TRI26_HUMAN Tripartite motif-containing protein 26 OS=Homo sapiens OX=9606 GN=TRIM26 PE=1 SV=1
13	Q5NCC9	1.21e-78	255	485	0.353	0.351	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
14	Q99PN3	1.28e-74	246	545	0.293	0.259	TRI26_MOUSE Tripartite motif-containing protein 26 OS=Mus musculus OX=10090 GN=Trim26 PE=2 SV=3
15	O00635	1.47e-72	238	465	0.320	0.331	TRI38_HUMAN E3 ubiquitin-protein ligase TRIM38 OS=Homo sapiens OX=9606 GN=TRIM38 PE=1 SV=1
16	A0A096LP39	7.78e-71	235	503	0.281	0.268	A0A096LP39_HUMAN Ribonuclease P protein subunit p21 OS=Homo sapiens OX=9606 GN=TRIM39-RPP21 PE=1 SV=1
17	A6NK02	4.34e-68	227	468	0.308	0.316	TRI75_HUMAN Tripartite motif-containing protein 75 OS=Homo sapiens OX=9606 GN=TRIM75 PE=3 SV=2
18	P19474	3.04e-67	225	475	0.318	0.322	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
19	Q99PQ2	4.06e-63	214	467	0.331	0.340	TRI11_MOUSE E3 ubiquitin-protein ligase TRIM11 OS=Mus musculus OX=10090 GN=Trim11 PE=1 SV=1
20	Q495X7	5.51e-63	214	471	0.293	0.299	TRI60_HUMAN Tripartite motif-containing protein 60 OS=Homo sapiens OX=9606 GN=TRIM60 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09936 Methyltrn_RNA_4	3.8e+02	12.3	SAM-dependent RNA methyltransferase
2	PF13765 PRY	5.7e-15	66.0	SPRY-associated domain
3	PF00622 SPRY	8.2e-09	47.0	SPRY domain
4	PF01017 STAT_alpha	5.1	18.5	STAT protein, all-alpha domain
5	PF00643 zf-B_box	1.3e-05	36.5	B-box zinc finger
6	PF00097 zf-C3HC4	2.9e-05	35.2	Zinc finger, C3HC4 type (RING finger)
7	PF13923 zf-C3HC4_2	0.00068	30.7	Zinc finger, C3HC4 type (RING finger)
8	PF13920 zf-C3HC4_3	0.00055	31.0	Zinc finger, C3HC4 type (RING finger)
9	PF15227 zf-C3HC4_4	2.9e-05	35.4	zinc finger of C3HC4-type, RING
10	PF12678 zf-rbx1	11	17.7	RING-H2 zinc finger domain
11	PF13639 zf-RING_2	0.0066	28.1	Ring finger domain
12	PF14634 zf-RING_5	0.059	24.7	zinc-RING finger domain
13	PF13445 zf-RING_UBOX	0.00017	32.8	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000397073

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365744	0.759	Proline-rich protein 3
2	9606.ENSP00000289788	0.755	Zinc finger and SCAN domain-containing protein 23
3	9606.ENSP00000441000	0.671	Valine--tRNA ligase, mitochondrial
4	9606.ENSP00000365963	0.666	Protein phosphatase 1 regulatory subunit 11
5	9606.ENSP00000291890	0.643	Natural cytotoxicity triggering receptor 1
6	9606.ENSP00000299413	0.636	Tripartite motif-containing protein 44
7	9606.ENSP00000259915	0.615	POU domain, class 5, transcription factor 1
8	9606.ENSP00000377690	0.610	Participates positively in the ciliary Hedgehog (Hh) signaling
9	9606.ENSP00000419298	0.610	Putative POU domain, class 5, transcription factor 1B
10	9606.ENSP00000352833	0.583	Tyrosine-protein phosphatase non-receptor type 22
11	9606.ENSP00000264260	0.582	Interleukin-18 receptor accessory protein
12	9606.ENSP00000301924	0.542	Tripartite motif-containing protein 35
13	9606.ENSP00000263707	0.523	Transcription factor CP2-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.344	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.993	regulation of biological process
GO:0050896	0.981	response to stimulus
GO:0009987	0.978	cellular process
GO:0050794	0.977	regulation of cellular process
GO:0048519	0.941	negative regulation of biological process
GO:0050792	0.935	regulation of viral process
GO:0006950	0.934	response to stress
GO:0002376	0.905	immune system process
GO:0048525	0.900	negative regulation of viral process
GO:0006952	0.860	defense response
GO:1903900	0.856	regulation of viral life cycle
GO:0009605	0.833	response to external stimulus
GO:0006955	0.833	immune response
GO:0044419	0.752	biological process involved in interspecies interaction between organisms
GO:0051707	0.710	response to other organism
GO:0019222	0.647	regulation of metabolic process
GO:0060255	0.593	regulation of macromolecule metabolic process
GO:1903901	0.587	negative regulation of viral life cycle
GO:0043903	0.582	regulation of biological process involved in symbiotic interaction
GO:0098542	0.577	defense response to other organism
GO:0045087	0.553	innate immune response
GO:0032501	0.545	multicellular organismal process
GO:0052372	0.526	modulation by symbiont of entry into host
GO:0046596	0.524	regulation of viral entry into host cell
GO:0031323	0.522	regulation of cellular metabolic process
GO:0010468	0.518	regulation of gene expression
GO:0080090	0.509	regulation of primary metabolic process
GO:0051171	0.509	regulation of nitrogen compound metabolic process
GO:0048518	0.464	positive regulation of biological process
GO:0019219	0.460	regulation of nucleobase-containing compound metabolic process
GO:0032502	0.456	developmental process
GO:0051716	0.443	cellular response to stimulus
GO:0048856	0.422	anatomical structure development
GO:0048522	0.407	positive regulation of cellular process
GO:0048523	0.392	negative regulation of cellular process
GO:0048583	0.388	regulation of response to stimulus
GO:0008152	0.376	metabolic process
GO:0051252	0.346	regulation of RNA metabolic process
GO:0071704	0.327	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.895	cytosol
GO:0043229	0.766	intracellular organelle
GO:0043231	0.727	intracellular membrane-bounded organelle
GO:0005634	0.332	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]