StarFunc result for job id Q9UDY8

User Input

>input (824 residues)
MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAEL
AGSRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQ
LLSPPGIKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAV
HVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESFQRSVDGVSESKLQICVEPTSQKLMP
GSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQD
SKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTTDQPLAKDKVALLIGNMNYREHPKLK
APLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENF
GNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDAL
KVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCH
LTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQI
QLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVS
KDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHRG
LGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSNVTPADSCHCS
RTPDAFISSFAHHASCHFSRSNVPVETTDEIPFSFSDRLRISEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1D5P1T2	0.526	0.531	0.000	816	0.689	0.696	A0A1D5P1T2.pdb.gz	A0A1D5P1T2_CHICK MALT1 paracaspase OS=Gallus gallus OX=9031 GN=PCASP1 PE=4 SV=1
2	AFDB:Q9UDY8	1.000	1.000	0.000	824	1.000	1.000	Q9UDY8.pdb.gz	MALT1_HUMAN Mucosa-associated lymphoid tissue lymphoma translocation protein 1 OS=Homo sapiens OX=9606 GN=MALT1 PE=1 SV=1
3	AFDB:B2RTX2	0.103	0.078	3.360E-15	1106	0.115	0.086	B2RTX2.pdb.gz	B2RTX2_HUMAN Palladin, cytoskeletal associated protein OS=Homo sapiens OX=9606 GN=PALLD PE=2 SV=1
4	AFDB:F1RE66	0.119	0.094	2.992E-14	1134	0.119	0.086	F1RE66.pdb.gz	F1RE66_DANRE Roundabout homolog 4 isoform X1 OS=Danio rerio OX=7955 GN=robo4 PE=4 SV=1
5	AFDB:Q15746	0.110	0.053	1.919E-13	1914	0.096	0.041	Q15746.pdb.gz	MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK PE=1 SV=4
6	AFDB:Q9W4Y6	0.139	0.120	2.261E-13	998	0.118	0.097	Q9W4Y6.pdb.gz	Q9W4Y6_DROME Brother of ihog, isoform B OS=Drosophila melanogaster OX=7227 GN=boi PE=1 SV=2
7	AFDB:Q6NY23	0.129	0.131	3.648E-11	807	0.123	0.125	Q6NY23.pdb.gz	Q6NY23_DANRE Kin of IRRE like (Drosophila) OS=Danio rerio OX=7955 GN=kirrel PE=1 SV=1
8	AFDB:B0CM22	0.130	0.137	5.349E-11	769	0.047	0.051	B0CM22.pdb.gz
9	AFDB:A8JNC7	0.133	0.198	9.239E-11	469	0.081	0.143	A8JNC7.pdb.gz	A8JNC7_DROME Dpr-interacting protein delta, isoform D OS=Drosophila melanogaster OX=7227 GN=DIP-delta PE=1 SV=2
10	AFDB:Q15109	0.108	0.212	1.780E-10	404	0.057	0.116	Q15109.pdb.gz	RAGE_HUMAN Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1
11	PDB:4fdlB	0.219	0.695	9.574E-10	239	0.053	0.184	4fdlB.pdb.gz
12	PDB:4pryA	0.214	0.652	1.329E-9	249	0.052	0.173	4pryA.pdb.gz	Selective inhibition of initiator versus executioner caspases using small peptides containing unnatural amino acids.
13	PDB:4nblA	0.226	0.655	2.705E-9	258	0.052	0.167	4nblA.pdb.gz	Tailoring small molecules for an allosteric site on procaspase-6.
14	PDB:6dldD	0.120	0.283	1.004E-8	269	0.042	0.130	6dldD.pdb.gz
15	PDB:5oj2B	0.092	0.109	1.250E-8	692	0.053	0.064	5oj2B.pdb.gz
16	PDB:6dlfA	0.117	0.330	2.408E-8	236	0.039	0.136	6dlfA.pdb.gz
17	PDB:6feyB	0.105	0.386	2.544E-8	207	0.036	0.145	6feyB.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
18	PDB:5c6wJ	0.085	0.255	3.531E-8	238	0.038	0.130	5c6wJ.pdb.gz
19	PDB:1e07A	0.116	0.139	6.804E-8	642	0.073	0.093	1e07A.pdb.gz
20	PDB:3o3uN	0.124	0.160	1.631E-7	580	0.050	0.071	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1D5P1T2	0.0	1155	816	0.692	0.699	A0A1D5P1T2_CHICK MALT1 paracaspase OS=Gallus gallus OX=9031 GN=PCASP1 PE=4 SV=1
2	Q2TBA3	0.0	1498	832	0.882	0.874	MALT1_MOUSE Mucosa-associated lymphoid tissue lymphoma translocation protein 1 homolog OS=Mus musculus OX=10090 GN=Malt1 PE=1 SV=2
3	Q9UDY8	0.0	1714	824	1.000	1.000	MALT1_HUMAN Mucosa-associated lymphoid tissue lymphoma translocation protein 1 OS=Homo sapiens OX=9606 GN=MALT1 PE=1 SV=1
4	K7EP42	3.28e-80	255	119	0.144	1.000	K7EP42_HUMAN MALT1 paracaspase (Fragment) OS=Homo sapiens OX=9606 GN=MALT1 PE=1 SV=1
5	Q05793	6.69e-12	72.4	3707	0.069	0.015	PGBM_MOUSE Basement membrane-specific heparan sulfate proteoglycan core protein OS=Mus musculus OX=10090 GN=Hspg2 PE=1 SV=1
6	O60926	9.83e-11	67.8	662	0.061	0.076	O60926_HUMAN CD22 protein OS=Homo sapiens OX=9606 GN=CD22 PE=4 SV=1
7	P10586	1.48e-10	67.8	1907	0.055	0.024	PTPRF_HUMAN Receptor-type tyrosine-protein phosphatase F OS=Homo sapiens OX=9606 GN=PTPRF PE=1 SV=2
8	P20273	1.71e-10	67.4	847	0.061	0.059	CD22_HUMAN B-cell receptor CD22 OS=Homo sapiens OX=9606 GN=CD22 PE=1 SV=2
9	A2A8L5	2.66e-10	67.0	1898	0.052	0.023	PTPRF_MOUSE Receptor-type tyrosine-protein phosphatase F OS=Mus musculus OX=10090 GN=Ptprf PE=1 SV=1
10	F1NWE3	3.18e-10	66.6	1516	0.053	0.029	PTPRS_CHICK Receptor-type tyrosine-protein phosphatase S OS=Gallus gallus OX=9031 GN=PTPRS PE=1 SV=3
11	P16621	3.50e-10	66.6	2029	0.058	0.024	LAR_DROME Tyrosine-protein phosphatase Lar OS=Drosophila melanogaster OX=7227 GN=Lar PE=1 SV=2
12	H9CWQ2	5.48e-10	65.9	1894	0.057	0.025	H9CWQ2_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=LAR PE=2 SV=1
13	P98160	6.08e-10	65.9	4391	0.064	0.012	PGBM_HUMAN Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4
14	A0A8I6A2S5	1.09e-09	65.1	4402	0.066	0.012	A0A8I6A2S5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
15	B0V2N1	1.09e-09	65.1	1907	0.053	0.023	PTPRS_MOUSE Receptor-type tyrosine-protein phosphatase S OS=Mus musculus OX=10090 GN=Ptprs PE=1 SV=1
16	Q64605	1.09e-09	65.1	1907	0.053	0.023	PTPRS_RAT Receptor-type tyrosine-protein phosphatase S OS=Rattus norvegicus OX=10116 GN=Ptprs PE=1 SV=2
17	A0A8I6ASH2	1.10e-09	65.1	4387	0.066	0.012	A0A8I6ASH2_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
18	Q3UQ28	1.24e-09	64.7	1475	0.063	0.035	PXDN_MOUSE Peroxidasin homolog OS=Mus musculus OX=10090 GN=Pxdn PE=1 SV=2
19	F1LTJ5	1.74e-09	64.3	2438	0.067	0.023	F1LTJ5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=4
20	G5EG33	1.82e-09	64.3	5198	0.068	0.011	G5EG33_CAEEL Hemicentin OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	3e-11	54.6	Immunoglobulin I-set domain
2	PF00047 ig	7.7e-13	59.8	Immunoglobulin domain
3	PF13895 Ig_2	3.7e-20	83.3	Immunoglobulin domain
4	PF13927 Ig_3	1e-20	85.3	Immunoglobulin domain
5	PF16680 Ig_4	0.01	27.7	T-cell surface glycoprotein CD3 delta chain
6	PF16681 Ig_5	0.00056	31.6	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
7	PF18452 Ig_6	2.3	19.5	Immunoglobulin domain
8	PF16706 Izumo-Ig	82	14.5	Izumo-like Immunoglobulin domain
9	PF18703 MALT1_Ig	4.6e-58	206.6	MALT1 Ig-like domain
10	PF00656 Peptidase_C14	8.6e-20	83.1	Caspase domain
11	PF07686 V-set	0.00073	31.1	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000319279

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359612	0.999	B-cell lymphoma/leukemia 10
2	9606.ENSP00000380150	0.999	Caspase recruitment domain-containing protein 11
3	9606.ENSP00000433623	0.999	TNF receptor-associated factor 6
4	9606.ENSP00000360797	0.997	Caspase recruitment domain-containing protein 9
5	9606.ENSP00000483825	0.995	NF-kappa-B essential modulator
6	9606.ENSP00000351273	0.992	Caspase-8
7	9606.ENSP00000384570	0.991	Caspase recruitment domain-containing protein 10
8	9606.ENSP00000316176	0.972	Ubiquitin-conjugating enzyme E2 N
9	9606.ENSP00000358335	0.966	Mitogen-activated protein kinase kinase kinase 7
10	9606.ENSP00000430684	0.965	Inhibitor of nuclear factor kappa-B kinase subunit beta
11	9606.ENSP00000359424	0.963	Inhibitor of nuclear factor kappa-B kinase subunit alpha
12	9606.ENSP00000263464	0.940	Baculoviral IAP repeat-containing protein 3
13	9606.ENSP00000454207	0.940	TNF receptor-associated factor 3
14	9606.ENSP00000263341	0.938	Interleukin-1 beta
15	9606.ENSP00000340305	0.936	Ubiquitin-conjugating enzyme E2 variant 1
16	9606.ENSP00000421689	0.931	Casein kinase I isoform alpha
17	9606.ENSP00000356426	0.908	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
18	9606.ENSP00000344220	0.907	3-phosphoinositide-dependent protein kinase 1
19	9606.ENSP00000263125	0.882	Protein kinase C theta type
20	9606.ENSP00000216797	0.877	NF-kappa-B inhibitor alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140096	0.997	catalytic activity, acting on a protein
GO:0042802	0.996	identical protein binding
GO:0016787	0.980	hydrolase activity
GO:0008233	0.973	peptidase activity
GO:0004175	0.964	endopeptidase activity
GO:0016740	0.962	transferase activity
GO:0098772	0.910	molecular function regulator activity
GO:0008047	0.890	enzyme activator activity
GO:0004842	0.786	ubiquitin-protein transferase activity
GO:0043621	0.755	protein self-association
GO:0019209	0.747	kinase activator activity
GO:0019899	0.711	enzyme binding
GO:0036094	0.676	small molecule binding
GO:0002020	0.331	protease binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.989	response to stimulus
GO:0009987	0.989	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0048518	0.986	positive regulation of biological process
GO:0060255	0.982	regulation of macromolecule metabolic process
GO:0048522	0.982	positive regulation of cellular process
GO:0007165	0.978	signal transduction
GO:0080090	0.977	regulation of primary metabolic process
GO:0051171	0.977	regulation of nitrogen compound metabolic process
GO:0048584	0.976	positive regulation of response to stimulus
GO:0010468	0.972	regulation of gene expression
GO:0065009	0.971	regulation of molecular function
GO:0031323	0.970	regulation of cellular metabolic process
GO:0009966	0.966	regulation of signal transduction
GO:0071704	0.965	organic substance metabolic process
GO:0010556	0.961	regulation of macromolecule biosynthetic process
GO:0031326	0.961	regulation of cellular biosynthetic process
GO:0051252	0.960	regulation of RNA metabolic process
GO:0032501	0.955	multicellular organismal process
GO:0051239	0.954	regulation of multicellular organismal process
GO:0051092	0.948	positive regulation of NF-kappaB transcription factor activity
GO:0002682	0.947	regulation of immune system process
GO:0044238	0.945	primary metabolic process
GO:0009893	0.945	positive regulation of metabolic process
GO:0051240	0.942	positive regulation of multicellular organismal process
GO:0007166	0.939	cell surface receptor signaling pathway
GO:0006950	0.935	response to stress
GO:0010604	0.930	positive regulation of macromolecule metabolic process
GO:0043170	0.926	macromolecule metabolic process
GO:0002684	0.920	positive regulation of immune system process
GO:0050776	0.919	regulation of immune response
GO:0006807	0.914	nitrogen compound metabolic process
GO:0048856	0.913	anatomical structure development
GO:0001817	0.907	regulation of cytokine production
GO:0050778	0.906	positive regulation of immune response
GO:0019538	0.904	protein metabolic process
GO:0050852	0.898	T cell receptor signaling pathway
GO:0043123	0.894	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0042221	0.893	response to chemical
GO:0001819	0.890	positive regulation of cytokine production
GO:0052547	0.873	regulation of peptidase activity
GO:0002824	0.873	positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0051249	0.867	regulation of lymphocyte activation
GO:0045862	0.857	positive regulation of proteolysis
GO:0051345	0.848	positive regulation of hydrolase activity
GO:0002699	0.842	positive regulation of immune effector process
GO:0051174	0.831	regulation of phosphorus metabolic process
GO:0052548	0.826	regulation of endopeptidase activity
GO:0006955	0.813	immune response
GO:0048519	0.794	negative regulation of biological process
GO:0010952	0.771	positive regulation of peptidase activity
GO:0043067	0.768	regulation of programmed cell death
GO:0010033	0.767	response to organic substance
GO:0010950	0.761	positive regulation of endopeptidase activity
GO:0071310	0.755	cellular response to organic substance
GO:0030154	0.751	cell differentiation
GO:0051094	0.742	positive regulation of developmental process
GO:0009605	0.740	response to external stimulus
GO:0009607	0.720	response to biotic stimulus
GO:0048468	0.717	cell development
GO:0044419	0.716	biological process involved in interspecies interaction between organisms
GO:0051707	0.712	response to other organism
GO:0031325	0.711	positive regulation of cellular metabolic process
GO:0006952	0.693	defense response
GO:0035556	0.667	intracellular signal transduction
GO:0031399	0.661	regulation of protein modification process
GO:2000026	0.655	regulation of multicellular organismal development
GO:0042325	0.646	regulation of phosphorylation
GO:0044237	0.606	cellular metabolic process
GO:0042327	0.604	positive regulation of phosphorylation
GO:0001932	0.594	regulation of protein phosphorylation
GO:0002706	0.577	regulation of lymphocyte mediated immunity
GO:0051179	0.576	localization
GO:0031401	0.570	positive regulation of protein modification process
GO:0006508	0.567	proteolysis
GO:0002709	0.538	regulation of T cell mediated immunity
GO:0002708	0.537	positive regulation of lymphocyte mediated immunity
GO:0048523	0.525	negative regulation of cellular process
GO:0042981	0.523	regulation of apoptotic process
GO:0080134	0.459	regulation of response to stress
GO:0031347	0.451	regulation of defense response
GO:0036211	0.430	protein modification process
GO:0032101	0.429	regulation of response to external stimulus
GO:0031349	0.390	positive regulation of defense response
GO:0034097	0.379	response to cytokine
GO:0032103	0.360	positive regulation of response to external stimulus
GO:0001934	0.356	positive regulation of protein phosphorylation
GO:0071345	0.315	cellular response to cytokine stimulus
GO:1901700	0.307	response to oxygen-containing compound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005829	1.000	cytosol
GO:0043233	0.995	organelle lumen
GO:0031981	0.985	nuclear lumen
GO:0043232	0.937	intracellular non-membrane-bounded organelle
GO:0140535	0.581	intracellular protein-containing complex
GO:0016020	0.440	membrane
GO:0005654	0.435	nucleoplasm
GO:0005730	0.423	nucleolus
GO:0005886	0.418	plasma membrane
GO:0032449	0.374	CBM complex
GO:0001650	0.347	fibrillar center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.980	Hydrolases.
EC:3.4.-.-	0.973	Acting on peptide bonds (peptidases).
EC:2.-.-.-	0.962	Transferases.

[back to server]