StarFunc result for job id Q9UEF7

User Input

>input (1012 residues)
MPASAPPRRPRPPPPSLSLLLVLLGLGGRRLRAEPGDGAQTWARFSRPPAPEAAGLFQGT
FPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLPLGAPSPLQPA
TGDVASDSYNNVFRDTEALRELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERL
RELGVQPVVTLYHWDLPQRLQDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNP
YVVAWHGYATGRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS
HWINPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILPDFTESEKKFI
KGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSWIDLEFNHPQIFIVENGWFVS
GTTKRDDAKYMYYLKKFIMETLKAIKLDGVDVIGYTAWSLMDGFEWHRGYSIRRGLFYVD
FLSQDKMLLPKSSALFYQKLIEKNGFPPLPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQ
FTDLNVYLWDVHHSKRLIKVDGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWA
LILPLGNQSQVNHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRLLARQGAWENP
YTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAGHNLLKAHALAWHVYNEKFRH
AQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGSGDYPWVMRDWLNQ
RNNFLLPYFTEDEKKLIQGTFDFLALSHYTTILVDSEKEDPIKYNDYLEVQEMTDITWLN
SPSQVAVVPWGLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALK
AHILDGINLCGYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDSNGFPGPETLE
RFCPEEFTVCTECSFFHTRKSLLAFIAFLFFASIISLSLIFYYSKKGRRSYK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35082	0.909	0.907	0.000	1014	0.859	0.857	O35082.pdb.gz	KLOT_MOUSE Klotho OS=Mus musculus OX=10090 GN=Kl PE=1 SV=2
2	AFDB:Q86Z14	0.808	0.785	0.000	1044	0.453	0.439	Q86Z14.pdb.gz	KLOTB_HUMAN Beta-klotho OS=Homo sapiens OX=9606 GN=KLB PE=1 SV=1
3	AFDB:Q99N32	0.856	0.832	0.000	1043	0.447	0.433	Q99N32.pdb.gz	KLOTB_MOUSE Beta-klotho OS=Mus musculus OX=10090 GN=Klb PE=1 SV=1
4	AFDB:Q9UEF7	1.000	1.000	0.000	1012	1.000	1.000	Q9UEF7.pdb.gz	KLOT_HUMAN Klotho OS=Homo sapiens OX=9606 GN=KL PE=1 SV=2
5	PDB:5vanA	0.755	0.878	8.930E-98	861	0.417	0.490	5vanA.pdb.gz	Structures of beta-klotho reveal a 'zip code'-like mechanism for endocrine FGF signalling.
6	AFDB:P09849	0.787	0.426	2.270E-88	1926	0.379	0.199	P09849.pdb.gz	LPH_RABIT Lactase/phlorizin hydrolase OS=Oryctolagus cuniculus OX=9986 GN=LCT PE=1 SV=1
7	AFDB:P09848	0.780	0.422	4.138E-87	1927	0.378	0.199	P09848.pdb.gz	LPH_HUMAN Lactase/phlorizin hydrolase OS=Homo sapiens OX=9606 GN=LCT PE=1 SV=3
8	AFDB:Q02401	0.797	0.427	6.475E-86	1928	0.386	0.203	Q02401.pdb.gz	LPH_RAT Lactase/phlorizin hydrolase OS=Rattus norvegicus OX=10116 GN=Lct PE=1 SV=2
9	AFDB:Q8K1F9	0.418	0.735	2.620E-44	566	0.206	0.367	Q8K1F9.pdb.gz	LCTL_MOUSE Lactase-like protein OS=Mus musculus OX=10090 GN=Lctl PE=1 SV=1
10	AFDB:Q9H227	0.406	0.862	4.587E-44	469	0.195	0.420	Q9H227.pdb.gz	GBA3_HUMAN Cytosolic beta-glucosidase OS=Homo sapiens OX=9606 GN=GBA3 PE=1 SV=2
11	PDB:2e9lA	0.402	0.860	4.494E-43	466	0.194	0.421	2e9lA.pdb.gz	Klotho-related protein is a novel cytosolic neutral beta-glycosylceramidase.
12	AFDB:Q9FIW4	0.405	0.825	1.604E-41	490	0.173	0.357	Q9FIW4.pdb.gz	BGL42_ARATH Beta-glucosidase 42 OS=Arabidopsis thaliana OX=3702 GN=BGLU42 PE=1 SV=1
13	PDB:7f3aA	0.397	0.829	2.723E-39	477	0.180	0.382	7f3aA.pdb.gz
14	PDB:3u57A	0.390	0.825	3.339E-39	471	0.174	0.374	3u57A.pdb.gz	Structures of alkaloid biosynthetic glucosidases decode substrate specificity.
15	PDB:2e3zA	0.400	0.865	1.619E-38	460	0.168	0.370	2e3zA.pdb.gz
16	PDB:2jf6B	0.391	0.826	1.866E-37	472	0.157	0.337	2jf6B.pdb.gz	Molecular Architecture of Strictosidine Glucosidase - the Gateway to the Biosynthesis of the Monoterpenoid Indole Alkaloid Family
17	PDB:3ahvA	0.395	0.831	4.669E-37	472	0.152	0.326	3ahvA.pdb.gz	The structural basis of oligosaccharide binding by rice BGlu1 beta-glucosidase
18	PDB:3ahyB	0.394	0.841	8.089E-36	466	0.157	0.341	3ahyB.pdb.gz	Structural and functional analysis of three beta-glucosidases from bacterium Clostridium cellulovorans, fungus Trichoderma reesei and termite Neotermes koshunensis
19	PDB:1e1eB	0.389	0.782	1.387E-33	495	0.151	0.309	1e1eB.pdb.gz
20	PDB:2xhyA	0.381	0.792	6.839E-25	470	0.128	0.277	2xhyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35082	0.0	1763	1014	0.842	0.840	KLOT_MOUSE Klotho OS=Mus musculus OX=10090 GN=Kl PE=1 SV=2
2	P09848	0.0	589	1927	0.360	0.189	LPH_HUMAN Lactase/phlorizin hydrolase OS=Homo sapiens OX=9606 GN=LCT PE=1 SV=3
3	P09849	0.0	588	1926	0.372	0.195	LPH_RABIT Lactase/phlorizin hydrolase OS=Oryctolagus cuniculus OX=9986 GN=LCT PE=1 SV=1
4	Q02401	0.0	624	1928	0.373	0.196	LPH_RAT Lactase/phlorizin hydrolase OS=Rattus norvegicus OX=10116 GN=Lct PE=1 SV=2
5	Q86Z14	0.0	899	1044	0.459	0.445	KLOTB_HUMAN Beta-klotho OS=Homo sapiens OX=9606 GN=KLB PE=1 SV=1
6	Q99N32	0.0	872	1043	0.451	0.437	KLOTB_MOUSE Beta-klotho OS=Mus musculus OX=10090 GN=Klb PE=1 SV=1
7	Q9UEF7	0.0	2103	1012	1.000	1.000	KLOT_HUMAN Klotho OS=Homo sapiens OX=9606 GN=KL PE=1 SV=2
8	Q9Z2Y9	0.0	1742	1014	0.829	0.827	KLOT_RAT Klotho OS=Rattus norvegicus OX=10116 GN=Kl PE=1 SV=1
9	W5PLZ6	0.0	644	1931	0.376	0.197	LPH_SHEEP Lactase/phlorizin hydrolase OS=Ovis aries OX=9940 GN=LCT PE=1 SV=1
10	Q9H227	1.34e-111	355	469	0.198	0.426	GBA3_HUMAN Cytosolic beta-glucosidase OS=Homo sapiens OX=9606 GN=GBA3 PE=1 SV=2
11	Q8K1F9	1.26e-109	353	566	0.199	0.355	LCTL_MOUSE Lactase-like protein OS=Mus musculus OX=10090 GN=Lctl PE=1 SV=1
12	Q8L7J2	3.25e-95	313	521	0.178	0.345	BGL06_ORYSJ Beta-glucosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU6 PE=1 SV=1
13	Q9FIW4	2.74e-93	307	490	0.175	0.361	BGL42_ARATH Beta-glucosidase 42 OS=Arabidopsis thaliana OX=3702 GN=BGLU42 PE=1 SV=1
14	Q25BW5	1.73e-91	301	462	0.176	0.385	BGL1A_PHACH Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
15	Q7XKV4	8.76e-89	296	510	0.180	0.357	BGL12_ORYSJ Beta-glucosidase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU12 PE=1 SV=2
16	Q9FZE0	9.74e-87	290	510	0.170	0.337	BGL40_ARATH Beta-glucosidase 40 OS=Arabidopsis thaliana OX=3702 GN=BGLU40 PE=2 SV=1
17	Q25BW4	5.69e-86	289	540	0.171	0.320	BGL1B_PHACH Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
18	Q8GU20	7.65e-86	288	532	0.167	0.318	SG1_RAUSE Strictosidine-O-beta-D-glucosidase OS=Rauvolfia serpentina OX=4060 GN=SGR1 PE=1 SV=1
19	Q9SLA0	4.86e-83	279	489	0.160	0.331	BGL14_ARATH Beta-glucosidase 14 OS=Arabidopsis thaliana OX=3702 GN=BGLU14 PE=3 SV=2
20	Q9FLU8	4.90e-82	278	534	0.177	0.335	BGL32_ARATH Beta-glucosidase 32 OS=Arabidopsis thaliana OX=3702 GN=BGLU32 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00232 Glyco_hydro_1	7e-203	685.7	Glycosyl hydrolase family 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369442

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000237837	0.999	Fibroblast growth factor 23
2	9606.ENSP00000393312	0.999	Fibroblast growth factor receptor 1
3	9606.ENSP00000292408	0.994	Fibroblast growth factor receptor 4
4	9606.ENSP00000339824	0.992	Fibroblast growth factor receptor 3
5	9606.ENSP00000294312	0.963	Fibroblast growth factor 19
6	9606.ENSP00000302728	0.941	Beta-glucuronidase
7	9606.ENSP00000263025	0.936	Mitogen-activated protein kinase 3
8	9606.ENSP00000407586	0.909	GTPase HRas
9	9606.ENSP00000268035	0.908	Insulin-like growth factor 1 receptor
10	9606.ENSP00000256078	0.907	GTPase KRas
11	9606.ENSP00000361140	0.904	Alcohol dehydrogenase [NADP(+)]
12	9606.ENSP00000215832	0.901	Mitogen-activated protein kinase 1
13	9606.ENSP00000358548	0.900	GTPase NRas
14	9606.ENSP00000410294	0.891	Fibroblast growth factor receptor 2
15	9606.ENSP00000293549	0.886	Proto-oncogene Wnt-1
16	9606.ENSP00000282091	0.884	Parathyroid hormone
17	9606.ENSP00000365016	0.875	Insulin receptor substrate 2
18	9606.ENSP00000304895	0.874	Insulin receptor substrate 1
19	9606.ENSP00000471477	0.870	Fibroblast growth factor 21
20	9606.ENSP00000215530	0.867	Fibroblast growth factor 22

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017134	1.000	fibroblast growth factor binding
GO:0008422	1.000	beta-glucosidase activity
GO:0005102	0.736	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.993	biological regulation
GO:0009987	0.970	cellular process
GO:0050789	0.962	regulation of biological process
GO:0050896	0.951	response to stimulus
GO:0050794	0.826	regulation of cellular process
GO:0008152	0.811	metabolic process
GO:0048518	0.755	positive regulation of biological process
GO:0044237	0.576	cellular metabolic process
GO:0071704	0.546	organic substance metabolic process
GO:0032502	0.533	developmental process
GO:0051716	0.509	cellular response to stimulus
GO:0048522	0.502	positive regulation of cellular process
GO:0032501	0.401	multicellular organismal process
GO:0044238	0.341	primary metabolic process
GO:0007154	0.339	cell communication
GO:0009719	0.332	response to endogenous stimulus
GO:0023052	0.329	signaling
GO:0042221	0.316	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005886	0.991	plasma membrane
GO:0005576	0.974	extracellular region
GO:0043227	0.968	membrane-bounded organelle
GO:0005615	0.891	extracellular space
GO:0031982	0.887	vesicle
GO:0005622	0.846	intracellular anatomical structure
GO:0043231	0.828	intracellular membrane-bounded organelle
GO:0070062	0.797	extracellular exosome
GO:0005737	0.545	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.21	1.000	beta-glucosidase.

[back to server]