StarFunc result for job id Q9UER7

User Input

>input (740 residues)
MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYK
LENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRP
AKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPR
TRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLC
ELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARH
SLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARR
LRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADTPEASLDSGEGPS
GMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDEEE
DEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAP
SSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTV
LENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHEKNG
KKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCIPSPARLSQTPHSQPPRPGTC
KTSVATQCDPEEIIVLSDSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RCS3	0.464	0.464	1.057E-83	740	1.000	1.000	A0A024RCS3.pdb.gz	A0A024RCS3_HUMAN Death domain-associated protein 6 OS=Homo sapiens OX=9606 PE=3 SV=1
2	AFDB:Q8VIB2	0.582	0.588	1.182E-68	731	0.732	0.741	Q8VIB2.pdb.gz	DAXX_RAT Death domain-associated protein 6 OS=Rattus norvegicus OX=10116 GN=Daxx PE=1 SV=1
3	AFDB:O35613	0.597	0.598	1.312E-65	739	0.715	0.716	O35613.pdb.gz	DAXX_MOUSE Death domain-associated protein 6 OS=Mus musculus OX=10090 GN=Daxx PE=1 SV=1
4	AFDB:Q54GH3	0.072	0.077	4.659E-3	663	0.108	0.121	Q54GH3.pdb.gz	TOM1_DICDI Target of Myb protein 1 OS=Dictyostelium discoideum OX=44689 GN=tom1 PE=1 SV=1
5	AFDB:A0A024RAY7	0.099	0.069	6.666E-3	1174	0.124	0.078	A0A024RAY7.pdb.gz
6	AFDB:Q6XZL8	0.074	0.039	1.112E-2	1540	0.158	0.076	Q6XZL8.pdb.gz	Q6XZL8_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Mus musculus OX=10090 GN=Dot1l PE=1 SV=1
7	AFDB:Q6PCP7	0.078	0.074	2.277E-2	798	0.107	0.099	Q6PCP7.pdb.gz	GP156_MOUSE Probable G-protein coupled receptor 156 OS=Mus musculus OX=10090 GN=Gpr156 PE=2 SV=2
8	AFDB:A2AUM9	0.048	0.029	2.941E-2	1736	0.146	0.062	A2AUM9.pdb.gz	CE152_MOUSE Centrosomal protein of 152 kDa OS=Mus musculus OX=10090 GN=Cep152 PE=1 SV=1
9	AFDB:Q86CW5	0.074	0.056	3.095E-2	1413	0.132	0.069	Q86CW5.pdb.gz	Q86CW5_DROME Hmr OS=Drosophila melanogaster OX=7227 GN=Hmr PE=4 SV=1
10	AFDB:Q8CB87	0.073	0.058	4.429E-2	973	0.168	0.127	Q8CB87.pdb.gz	RAB44_MOUSE Ras-related protein Rab-44 OS=Mus musculus OX=10090 GN=Rab44 PE=1 SV=2
11	PDB:2noxB	0.064	0.151	1.753E-1	266	0.047	0.132	2noxB.pdb.gz	Crystal structure and mechanism of tryptophan 2,3-dioxygenase, a heme enzyme involved in tryptophan catabolism and in quinolinate biosynthesis.
12	PDB:4f7rD	0.070	0.164	6.632E-1	238	0.038	0.118	4f7rD.pdb.gz
13	PDB:4ga6A	0.051	0.070	8.139E-1	493	0.027	0.041	4ga6A.pdb.gz	Structure analysis of archaeal AMP phosphorylase reveals two unique modes of dimerization
14	PDB:6nr7A	0.076	0.056	9.016E-1	1086	0.059	0.041	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling
15	PDB:7c4jB	0.051	0.081	1.504	395	0.076	0.142	7c4jB.pdb.gz
16	PDB:7n6g3I	0.063	0.111	1.583	401	0.054	0.100	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
17	PDB:3euhB	0.068	0.131	1.754	321	0.027	0.062	3euhB.pdb.gz
18	PDB:3axjA	0.063	0.158	2.152	225	0.034	0.111	3axjA.pdb.gz
19	PDB:3ipmO	0.070	0.189	2.265	219	0.039	0.132	3ipmO.pdb.gz
20	PDB:1a9wE	0.053	0.171	2.384	145	0.028	0.145	1a9wE.pdb.gz	Crystal structure of a human embryonic haemoglobin: the carbonmonoxy form of gower II (alpha2 epsilon2) haemoglobin at 2.9 A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024RCS3	0.0	1496	740	1.000	1.000	A0A024RCS3_HUMAN Death domain-associated protein 6 OS=Homo sapiens OX=9606 PE=3 SV=1
2	O18805	0.0	1248	736	0.919	0.924	DAXX_CHLAE Death domain-associated protein 6 OS=Chlorocebus aethiops OX=9534 GN=DAXX PE=2 SV=1
3	O35613	0.0	889	739	0.700	0.701	DAXX_MOUSE Death domain-associated protein 6 OS=Mus musculus OX=10090 GN=Daxx PE=1 SV=1
4	Q8VIB2	0.0	902	731	0.728	0.737	DAXX_RAT Death domain-associated protein 6 OS=Rattus norvegicus OX=10116 GN=Daxx PE=1 SV=1
5	Q9UER7	0.0	1496	740	1.000	1.000	DAXX_HUMAN Death domain-associated protein 6 OS=Homo sapiens OX=9606 GN=DAXX PE=1 SV=2
6	Q4VX54	2.29e-123	367	178	0.241	1.000	Q4VX54_HUMAN Death domain associated protein (Fragment) OS=Homo sapiens OX=9606 GN=DAXX PE=1 SV=1
7	Q1LUU4	1.31e-111	356	716	0.257	0.265	Q1LUU4_DANRE Death domain-associated protein 6 OS=Danio rerio OX=7955 GN=si:dz179b20.7 PE=1 SV=1
8	Q5UDQ8	7.99e-27	120	1620	0.138	0.063	Q5UDQ8_DROME DAXX OS=Drosophila melanogaster OX=7227 GN=Daxx PE=2 SV=1
9	Q95TR4	1.14e-26	119	950	0.128	0.100	Q95TR4_DROME LD29187p OS=Drosophila melanogaster OX=7227 GN=Daxx PE=2 SV=1
10	Q9VMD0	1.17e-26	119	1659	0.138	0.061	DAXX_DROME Daxx-like protein OS=Drosophila melanogaster OX=7227 GN=Daxx PE=1 SV=3
11	Q8WSS9	1.72e-26	119	1645	0.138	0.062	Q8WSS9_DROME Daxx-like protein OS=Drosophila melanogaster OX=7227 GN=Daxx PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03344 Daxx	7.7e-47	168.8	Daxx N-terminal Rassf1C-interacting domain
2	PF07133 Merozoite_SPAM	6.1e+02	11.8	Merozoite surface protein (SPAM)
3	PF04147 Nop14	6.6e+02	9.9	Nop14-like family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363668

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254810	0.999	H3 histone, family 3B (H3.3B)
2	9606.ENSP00000258149	0.999	E3 ubiquitin-protein ligase Mdm2
3	9606.ENSP00000268058	0.999	Protein PML
4	9606.ENSP00000269305	0.999	Cellular tumor antigen p53
5	9606.ENSP00000343535	0.999	Ubiquitin carboxyl-terminal hydrolase 7
6	9606.ENSP00000351908	0.999	Mitogen-activated protein kinase kinase kinase 5
7	9606.ENSP00000362441	0.999	Transcriptional regulator ATRX
8	9606.ENSP00000376077	0.999	Small ubiquitin-related modifier 1
9	9606.ENSP00000348056	0.998	SUMO-conjugating enzyme UBC9
10	9606.ENSP00000248553	0.996	Heat shock protein beta-1
11	9606.ENSP00000347979	0.995	Tumor necrosis factor receptor superfamily member 6
12	9606.ENSP00000343023	0.994	Nuclear autoantigen Sp-100
13	9606.ENSP00000352516	0.994	DNA (cytosine-5)-methyltransferase 1
14	9606.ENSP00000244537	0.992	Histone cluster 1 H4 family member f
15	9606.ENSP00000253024	0.991	Transcription intermediary factor 1-beta
16	9606.ENSP00000355778	0.990	Histone H3.3
17	9606.ENSP00000362649	0.990	Histone deacetylase 1
18	9606.ENSP00000376436	0.987	Protein C-ets-1
19	9606.ENSP00000303394	0.983	Heat shock protein beta-3
20	9606.ENSP00000367034	0.982	Histone cluster 1 H4 family member c

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003714	1.000	transcription corepressor activity
GO:0019899	0.958	enzyme binding
GO:0042393	0.900	histone binding
GO:0003713	0.814	transcription coactivator activity
GO:0008134	0.801	transcription factor binding
GO:0140297	0.785	DNA-binding transcription factor binding
GO:0061629	0.652	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0050681	0.611	nuclear androgen receptor binding
GO:0019900	0.569	kinase binding
GO:0019901	0.545	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0060255	0.983	regulation of macromolecule metabolic process
GO:0080090	0.981	regulation of primary metabolic process
GO:0051171	0.981	regulation of nitrogen compound metabolic process
GO:0031323	0.981	regulation of cellular metabolic process
GO:0048519	0.975	negative regulation of biological process
GO:0010468	0.974	regulation of gene expression
GO:0010556	0.973	regulation of macromolecule biosynthetic process
GO:0031326	0.973	regulation of cellular biosynthetic process
GO:0048522	0.971	positive regulation of cellular process
GO:0050896	0.965	response to stimulus
GO:0048523	0.965	negative regulation of cellular process
GO:0051173	0.947	positive regulation of nitrogen compound metabolic process
GO:0006355	0.943	regulation of DNA-templated transcription
GO:0051716	0.941	cellular response to stimulus
GO:0010604	0.927	positive regulation of macromolecule metabolic process
GO:0031325	0.916	positive regulation of cellular metabolic process
GO:0071840	0.899	cellular component organization or biogenesis
GO:0010605	0.897	negative regulation of macromolecule metabolic process
GO:0051172	0.896	negative regulation of nitrogen compound metabolic process
GO:0031324	0.895	negative regulation of cellular metabolic process
GO:0016043	0.893	cellular component organization
GO:0045892	0.886	negative regulation of DNA-templated transcription
GO:0010941	0.866	regulation of cell death
GO:0065009	0.659	regulation of molecular function
GO:0006950	0.649	response to stress
GO:0007165	0.634	signal transduction
GO:0044093	0.603	positive regulation of molecular function
GO:0031399	0.603	regulation of protein modification process
GO:0050790	0.574	regulation of catalytic activity
GO:0033554	0.542	cellular response to stress
GO:0042221	0.523	response to chemical
GO:0070887	0.476	cellular response to chemical stimulus
GO:0006357	0.467	regulation of transcription by RNA polymerase II
GO:0022607	0.459	cellular component assembly
GO:0006325	0.449	chromatin organization
GO:0043933	0.431	protein-containing complex organization
GO:0012501	0.430	programmed cell death
GO:0006338	0.430	chromatin remodeling
GO:0051247	0.386	positive regulation of protein metabolic process
GO:0006915	0.378	apoptotic process
GO:0065003	0.376	protein-containing complex assembly
GO:0042325	0.373	regulation of phosphorylation
GO:0010942	0.358	positive regulation of cell death
GO:0008152	0.357	metabolic process
GO:0071704	0.352	organic substance metabolic process
GO:0010033	0.342	response to organic substance
GO:0045935	0.326	positive regulation of nucleobase-containing compound metabolic process
GO:0051338	0.325	regulation of transferase activity
GO:0071824	0.319	protein-DNA complex subunit organization
GO:0001932	0.310	regulation of protein phosphorylation
GO:0043549	0.308	regulation of kinase activity
GO:0034728	0.306	nucleosome organization
GO:0097190	0.301	apoptotic signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0016604	0.992	nuclear body
GO:0043232	0.943	intracellular non-membrane-bounded organelle
GO:0005829	0.927	cytosol
GO:0005694	0.816	chromosome
GO:0032991	0.649	protein-containing complex
GO:0016605	0.555	PML body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]