StarFunc result for job id Q9UET6

User Input

>input (329 residues)
MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCAAPGSWSQVLS
QKIGGQGSGHVVAVDLQAMAPLPGVVQIQGDITQLSTAKEIIQHFKGCPADLVVCDGAPD
VTGLHDVDEYMQAQLLLAALNIATHVLKPGGCFVAKIFRGRDVTLLYSQLQVFFSSVLCA
KPRSSRNSSIEAFAVCQGYDPPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVTCGD
LSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRV
DTFPQPLAAPQCHTLLAPEMEDNEMSCSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UET6	1.000	1.000	2.628E-71	329	1.000	1.000	Q9UET6.pdb.gz	TRM7_HUMAN tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Homo sapiens OX=9606 GN=FTSJ1 PE=1 SV=2
2	AFDB:O36015	0.780	0.895	7.427E-43	285	0.514	0.593	O36015.pdb.gz	TRM7_SCHPO tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm7 PE=1 SV=1
3	AFDB:P38238	0.764	0.808	5.169E-39	310	0.462	0.490	P38238.pdb.gz	TRM7_YEAST tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRM7 PE=1 SV=1
4	AFDB:Q9VDD9	0.754	0.774	4.536E-36	320	0.435	0.447	Q9VDD9.pdb.gz	TRM72_DROME tRNA (guanosine(34)-2'-O)-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Trm7-34 PE=1 SV=1
5	AFDB:Q9VEP1	0.605	0.658	2.351E-31	302	0.407	0.444	Q9VEP1.pdb.gz	TRM71_DROME tRNA (cytidine(32)-2'-O)-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Trm7-32 PE=1 SV=1
6	PDB:6jplB	0.613	0.862	1.459E-28	231	0.365	0.519	6jplB.pdb.gz	Structure of tRNA methyltransferase complex of Trm7 and Trm734 reveals a novel binding interface for tRNA recognition.
7	AFDB:Q586Q7	0.613	0.231	3.456E-24	905	0.289	0.105	Q586Q7.pdb.gz	Q586Q7_TRYB2 Putative rRNA methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.305 PE=3 SV=1
8	AFDB:Q8IY81	0.595	0.241	3.523E-23	847	0.289	0.112	Q8IY81.pdb.gz	SPB1_HUMAN pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2
9	AFDB:P25582	0.600	0.243	7.480E-23	841	0.274	0.107	P25582.pdb.gz	SPB1_YEAST 27S pre-rRNA (guanosine(2922)-2'-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPB1 PE=1 SV=2
10	AFDB:O42832	0.593	0.249	5.933E-22	802	0.258	0.106	O42832.pdb.gz	SPB1_SCHPO AdoMet-dependent rRNA methyltransferase spb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spb1 PE=1 SV=2
11	PDB:7nacw	0.583	0.291	6.114E-22	672	0.274	0.134	7nacw.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
12	AFDB:F4JTD2	0.609	0.254	1.044E-21	821	0.255	0.102	F4JTD2.pdb.gz	F4JTD2_ARATH Putative rRNA methyltransferase OS=Arabidopsis thaliana OX=3702 GN=TRM7B PE=1 SV=1
13	PDB:6elzw	0.545	0.415	3.310E-18	436	0.231	0.174	6elzw.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
14	PDB:7o9mn	0.560	0.848	8.485E-18	215	0.207	0.316	7o9mn.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
15	PDB:6ylxw	0.521	0.480	3.440E-16	360	0.234	0.214	6ylxw.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
16	PDB:3ssmB	0.339	0.318	4.634E-7	354	0.128	0.119	3ssmB.pdb.gz	A new structural form in the SAM/metal-dependent o‑methyltransferase family: MycE from the mycinamicin biosynthetic pathway.
17	PDB:3a4tA	0.357	0.439	1.188E-6	258	0.097	0.124	3a4tA.pdb.gz	Crystal structure of Methanocaldococcus jannaschii Trm4 complexed with sinefungin.
18	PDB:5mgzA	0.328	0.448	1.527E-6	230	0.112	0.161	5mgzA.pdb.gz	Structural and Functional Basis of C-Methylation of Coumarin Scaffolds by NovO.
19	PDB:6u1xA	0.377	0.067	2.225E-6	2059	0.094	0.015	6u1xA.pdb.gz	Structure of the Vesicular Stomatitis Virus L Protein in Complex with Its Phosphoprotein Cofactor.
20	PDB:3ssoB	0.342	0.294	2.369E-6	394	0.103	0.086	3ssoB.pdb.gz	A new structural form in the SAM/metal-dependent o‑methyltransferase family: MycE from the mycinamicin biosynthetic pathway.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UET6	0.0	676	329	1.000	1.000	TRM7_HUMAN tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Homo sapiens OX=9606 GN=FTSJ1 PE=1 SV=2
2	O36015	8.36e-113	330	285	0.517	0.596	TRM7_SCHPO tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm7 PE=1 SV=1
3	P38238	3.35e-94	284	310	0.465	0.494	TRM7_YEAST tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRM7 PE=1 SV=1
4	Q9VEP1	7.36e-93	280	302	0.447	0.487	TRM71_DROME tRNA (cytidine(32)-2'-O)-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Trm7-32 PE=1 SV=1
5	Q9VDD9	6.11e-91	276	320	0.441	0.453	TRM72_DROME tRNA (guanosine(34)-2'-O)-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Trm7-34 PE=1 SV=1
6	Q586Q7	1.68e-45	167	905	0.283	0.103	Q586Q7_TRYB2 Putative rRNA methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.305 PE=3 SV=1
7	Q8IY81	2.42e-44	164	847	0.295	0.115	SPB1_HUMAN pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3 OS=Homo sapiens OX=9606 GN=FTSJ3 PE=1 SV=2
8	O42832	3.13e-41	155	802	0.261	0.107	SPB1_SCHPO AdoMet-dependent rRNA methyltransferase spb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spb1 PE=1 SV=2
9	P25582	4.84e-40	151	841	0.286	0.112	SPB1_YEAST 27S pre-rRNA (guanosine(2922)-2'-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPB1 PE=1 SV=2
10	F4JTD2	1.41e-31	127	821	0.258	0.104	F4JTD2_ARATH Putative rRNA methyltransferase OS=Arabidopsis thaliana OX=3702 GN=TRM7B PE=1 SV=1
11	Q9UI43	8.02e-31	118	246	0.213	0.285	MRM2_HUMAN rRNA methyltransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=MRM2 PE=1 SV=1
12	P0C0R7	1.99e-29	114	209	0.207	0.325	RLME_ECOLI Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli (strain K12) OX=83333 GN=rlmE PE=1 SV=1
13	Q9CPY0	3.06e-29	114	246	0.204	0.272	MRM2_MOUSE rRNA methyltransferase 2, mitochondrial OS=Mus musculus OX=10090 GN=Mrm2 PE=1 SV=1
14	P78860	8.27e-26	104	218	0.191	0.289	MRM2_SCHPO rRNA methyltransferase 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mrm2 PE=2 SV=2
15	Q9VDT6	1.19e-19	88.6	250	0.176	0.232	MRM2_DROME rRNA methyltransferase 2, mitochondrial OS=Drosophila melanogaster OX=7227 GN=CG11447 PE=2 SV=1
16	Q38AH0	2.33e-09	60.1	370	0.182	0.162	MTR1_TRYB2 Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=MTR1 PE=1 SV=1
17	Q57Y21	3.44e-09	59.3	284	0.182	0.211	Q57Y21_TRYB2 rRNA methyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.360 PE=4 SV=1
18	P53123	3.34e-08	56.6	320	0.100	0.103	MRM2_YEAST rRNA methyltransferase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRM2 PE=1 SV=1
19	Q9UAS6	1.93e-06	51.6	700	0.112	0.053	CMTR2_DROME Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 2 OS=Drosophila melanogaster OX=7227 GN=cmtr2 PE=2 SV=2
20	Q9W4N2	9.59e-06	49.7	788	0.128	0.053	CMTR1_DROME Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=Cmtr1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01728 FtsJ	3.3e-66	234.3	FtsJ-like methyltransferase
2	PF13649 Methyltransf_25	1.5e+02	14.5	Methyltransferase domain
3	PF01189 Methyltr_RsmB-F	6.3e+02	11.4	16S rRNA methyltransferase RsmB/F
4	PF01209 Ubie_methyltran	67	14.3	ubiE/COQ5 methyltransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000326948

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378857	0.997	WD repeat-containing protein 6
2	9606.ENSP00000203001	0.913	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6
3	9606.ENSP00000264670	0.913	tRNA (cytosine(34)-C(5))-methyltransferase
4	9606.ENSP00000333934	0.906	tRNA (guanine(10)-N2)-methyltransferase homolog
5	9606.ENSP00000261015	0.905	Ribosome biogenesis protein WDR12
6	9606.ENSP00000466967	0.900	tRNA (guanine(26)-N(2))-dimethyltransferase
7	9606.ENSP00000381266	0.896	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4
8	9606.ENSP00000385995	0.895	Thyroid adenoma-associated protein
9	9606.ENSP00000254940	0.889	60S ribosome subunit biogenesis protein NIP7 homolog
10	9606.ENSP00000261249	0.877	tRNA (guanine(37)-N1)-methyltransferase
11	9606.ENSP00000374399	0.873	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A
12	9606.ENSP00000314441	0.871	tRNA (guanine-N(7)-)-methyltransferase
13	9606.ENSP00000227474	0.863	tRNA pseudouridine(38/39) synthase
14	9606.ENSP00000348722	0.863	Pseudouridylate synthase that catalyzes pseudouridylation of RNAs . Acts as a regulator of protein synthesis in embryonic stem cells by mediating pseudouridylation of RNA fragments derived from tRNAs (tRFs): pseudouridylated tRFs inhibit translation by targeting the translation initiation complex . Also catalyzes pseudouridylation of mRNAs: mediates pseudouridylation of mRNAs with the consensus sequence 5'-UGUAG-3' . In addition to mRNAs and tRNAs, binds other types of RNAs, such as snRNAs, Y RNAs and vault RNAs, suggesting that it can catalyze pseudouridylation of many RNA types
15	9606.ENSP00000273962	0.847	tRNA methyltransferase 10 homolog A
16	9606.ENSP00000365837	0.839	tRNA pseudouridine synthase A
17	9606.ENSP00000397673	0.839	Alkylated DNA repair protein alkB homolog 8
18	9606.ENSP00000332448	0.828	Probable inactive tRNA-specific adenosine deaminase-like protein 3
19	9606.ENSP00000374387	0.817	Probable tRNA (uracil-O(2)-)-methyltransferase
20	9606.ENSP00000338862	0.802	Ribosome biogenesis protein BRX1 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0062105	1.000	RNA 2'-O-methyltransferase activity
GO:0016423	1.000	tRNA (guanine) methyltransferase activity
GO:0052666	0.997	tRNA (cytosine-2'-O-)-methyltransferase activity
GO:0106050	0.959	tRNA 2'-O-methyltransferase activity
GO:0009020	0.805	tRNA (guanosine-2'-O-)-methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030488	0.995	tRNA methylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005829	0.994	cytosol
GO:0031981	0.975	nuclear lumen
GO:0005654	0.960	nucleoplasm
GO:0043232	0.947	intracellular non-membrane-bounded organelle
GO:0005730	0.335	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:58956	1.000	a ribonucleotide in RNA + S-adenosyl-L-methionine = a 2'-O-methylribonucleotide in RNA + H(+) + S-adenosyl-L-homocysteine
RHEA:20077	0.805	guanosine(18) in tRNA + S-adenosyl-L-methionine = 2'-O-methylguanosine(18) in tRNA + H(+) + S-adenosyl-L-homocysteine
EC:2.1.1.34	0.805	tRNA (guanosine(18)-2'-O)-methyltransferase.

[back to server]