StarFunc result for job id Q9UEW8

User Input

>input (545 residues)
MAEPSGSPVHVQLPQQAAPVTAAAAAAPAAATAAPAPAAPAAPAPAPAPAAQAVGWPICR
DAYELQEVIGSGATAVVQAALCKPRQERVAIKRINLEKCQTSMDELLKEIQAMSQCSHPN
VVTYYTSFVVKDELWLVMKLLSGGSMLDIIKYIVNRGEHKNGVLEEAIIATILKEVLEGL
DYLHRNGQIHRDLKAGNILLGEDGSVQIADFGVSAFLATGGDVTRNKVRKTFVGTPCWMA
PEVMEQVRGYDFKADMWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPTLETGVEDK
EMMKKYGKSFRKLLSLCLQKDPSKRPTAAELLKCKFFQKAKNREYLIEKLLTRTPDIAQR
AKKVRRVPGSSGHLHKTEDGDWEWSDDEMDEKSEEGKAAFSQEKSRRVKEENPEIAVSAS
TIPEQIQSLSVHDSQGPPNANEDYREASSCAVNLVLRLRNSRKELNDIRFEFTPGRDTAD
GVSQELFSAGLVDGHDVVIVAANLQKIVDDPKALKTLTFKLASGCDGSEIPDEVKLIGFA
QLSVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Z1W9	0.633	0.621	3.184E-95	556	0.972	0.953	Q9Z1W9.pdb.gz	STK39_MOUSE STE20/SPS1-related proline-alanine-rich protein kinase OS=Mus musculus OX=10090 GN=Stk39 PE=1 SV=1
2	AFDB:O95747	0.711	0.733	7.360E-78	527	0.710	0.734	O95747.pdb.gz	OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens OX=9606 GN=OXSR1 PE=1 SV=1
3	AFDB:Q7KSD3	0.626	0.619	4.995E-63	552	0.543	0.536	Q7KSD3.pdb.gz	Q7KSD3_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=fray PE=1 SV=1
4	AFDB:G5EEN4	0.636	0.587	2.500E-62	596	0.519	0.475	G5EEN4.pdb.gz	GCK3_CAEEL Germinal center kinase 3 OS=Caenorhabditis elegans OX=6239 GN=gck-3 PE=1 SV=1
5	AFDB:Q84WU5	0.523	0.426	1.054E-35	674	0.310	0.251	Q84WU5.pdb.gz	Q84WU5_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g14720 PE=1 SV=1
6	AFDB:F4JMF4	0.521	0.403	3.682E-34	711	0.299	0.229	F4JMF4.pdb.gz	F4JMF4_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g10730 PE=1 SV=1
7	AFDB:Q54XL6	0.514	0.488	4.755E-31	574	0.261	0.247	Q54XL6.pdb.gz	FRAY1_DICDI Serine/threonine-protein kinase fray1 OS=Dictyostelium discoideum OX=44689 GN=fray1 PE=3 SV=1
8	AFDB:O23304	0.521	0.580	6.635E-31	487	0.272	0.304	O23304.pdb.gz	BLUS1_ARATH Serine/threonine-protein kinase BLUS1 OS=Arabidopsis thaliana OX=3702 GN=BLUS1 PE=1 SV=1
9	AFDB:F8W562	0.475	0.605	7.415E-31	421	0.292	0.378	F8W562.pdb.gz	F8W562_DANRE Serine/threonine kinase 25a OS=Danio rerio OX=7955 GN=zgc:92836 PE=4 SV=1
10	AFDB:Q7ZVG8	0.479	0.608	1.613E-30	424	0.277	0.356	Q7ZVG8.pdb.gz	Q7ZVG8_DANRE Serine/threonine kinase 25 (STE20 homolog, yeast) OS=Danio rerio OX=7955 GN=stk25 PE=2 SV=1
11	PDB:3eqdA	0.429	0.722	2.708E-20	315	0.143	0.248	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
12	PDB:4mk0A	0.439	0.382	1.001E-18	631	0.161	0.139	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
13	PDB:4eomC	0.425	0.804	2.719E-18	276	0.143	0.283	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
14	PDB:7myjC	0.413	0.478	5.294E-18	465	0.172	0.202	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
15	PDB:5u6yA	0.412	0.484	8.255E-18	459	0.161	0.192	5u6yA.pdb.gz
16	PDB:6s73A	0.431	0.847	9.225E-18	269	0.132	0.268	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
17	PDB:4krcA	0.425	0.751	1.218E-17	297	0.132	0.242	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
18	PDB:1unlA	0.425	0.759	1.699E-17	292	0.134	0.250	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
19	PDB:2h8hA	0.427	0.517	2.506E-17	445	0.141	0.173	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
20	PDB:6pjxA	0.446	0.448	2.650E-17	543	0.149	0.149	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9JIG9	0.0	669	468	0.622	0.724	C9JIG9_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=OXSR1 PE=1 SV=1
2	G5EEN4	0.0	534	596	0.510	0.466	GCK3_CAEEL Germinal center kinase 3 OS=Caenorhabditis elegans OX=6239 GN=gck-3 PE=1 SV=1
3	O88506	0.0	1082	553	0.978	0.964	STK39_RAT STE20/SPS1-related proline-alanine-rich protein kinase OS=Rattus norvegicus OX=10116 GN=Stk39 PE=1 SV=2
4	O95747	0.0	774	527	0.714	0.738	OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens OX=9606 GN=OXSR1 PE=1 SV=1
5	Q6P9R2	0.0	771	527	0.706	0.731	OXSR1_MOUSE Serine/threonine-protein kinase OSR1 OS=Mus musculus OX=10090 GN=Oxsr1 PE=1 SV=1
6	Q7KSD3	0.0	589	552	0.554	0.547	Q7KSD3_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=fray PE=1 SV=1
7	Q9UEW8	0.0	1127	545	1.000	1.000	STK39_HUMAN STE20/SPS1-related proline-alanine-rich protein kinase OS=Homo sapiens OX=9606 GN=STK39 PE=1 SV=3
8	Q9VE62	0.0	590	552	0.554	0.547	Q9VE62_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=fray PE=2 SV=3
9	Q9Z1W9	0.0	1075	556	0.969	0.950	STK39_MOUSE STE20/SPS1-related proline-alanine-rich protein kinase OS=Mus musculus OX=10090 GN=Stk39 PE=1 SV=1
10	Q84WU5	1.70e-104	330	674	0.323	0.261	Q84WU5_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g14720 PE=1 SV=1
11	F4JMF4	2.37e-95	307	711	0.275	0.211	F4JMF4_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g10730 PE=1 SV=1
12	Q54XL6	8.39e-76	252	574	0.240	0.228	FRAY1_DICDI Serine/threonine-protein kinase fray1 OS=Dictyostelium discoideum OX=44689 GN=fray1 PE=3 SV=1
13	Q8IGS1	2.39e-74	250	642	0.273	0.232	Q8IGS1_DROME RE38276p OS=Drosophila melanogaster OX=7227 GN=GckIII PE=2 SV=1
14	Q9VEN3	2.55e-74	250	642	0.273	0.232	Q9VEN3_DROME FI20177p1 OS=Drosophila melanogaster OX=7227 GN=GckIII PE=1 SV=1
15	O61122	1.42e-73	243	478	0.250	0.285	SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum OX=44689 GN=svkA PE=1 SV=1
16	F8W562	1.45e-72	239	421	0.239	0.309	F8W562_DANRE Serine/threonine kinase 25a OS=Danio rerio OX=7955 GN=zgc:92836 PE=4 SV=1
17	Q7ZVG8	6.92e-72	238	424	0.242	0.311	Q7ZVG8_DANRE Serine/threonine kinase 25 (STE20 homolog, yeast) OS=Danio rerio OX=7955 GN=stk25 PE=2 SV=1
18	Q6V9V9	3.84e-71	236	426	0.235	0.300	Q6V9V9_RAT Serine/threonine kinase 25 OS=Rattus norvegicus OX=10116 GN=Stk25 PE=1 SV=1
19	Q9Z2W1	3.84e-71	236	426	0.235	0.300	STK25_MOUSE Serine/threonine-protein kinase 25 OS=Mus musculus OX=10090 GN=Stk25 PE=1 SV=2
20	Q96BA2	5.11e-71	235	426	0.235	0.300	Q96BA2_HUMAN STK25 protein OS=Homo sapiens OX=9606 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.024	25.3	ABC1 atypical kinase-like domain
2	PF01636 APH	1.3e+02	13.8	Phosphotransferase enzyme family
3	PF06293 Kdo	2.5e+02	12.4	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF14531 Kinase-like	20	16.0	Kinase-like
5	PF12202 OSR1_C	1.7e-20	84.2	Oxidative-stress-responsive kinase 1 C-terminal domain
6	PF00069 Pkinase	2.2e-59	212.6	Protein kinase domain
7	PF17667 Pkinase_fungal	3.3	18.0	Fungal protein kinase
8	PF07714 PK_Tyr_Ser-Thr	7.8e-43	158.2	Protein tyrosine and serine/threonine kinase
9	PF19974 TCAD9	5.5e+02	10.9	Ternary complex associated domain 9
10	PF15636 Tox-GHH	3.9e+02	12.4	GHH signature containing HNH/Endo VII superfamily nuclease toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348278

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262461	0.984	Solute carrier family 12 member 2
2	9606.ENSP00000258418	0.964	Calcium-binding protein 39
3	9606.ENSP00000313875	0.953	Membrane cofactor protein
4	9606.ENSP00000263125	0.940	Protein kinase C theta type
5	9606.ENSP00000379822	0.936	Solute carrier family 12 member 1
6	9606.ENSP00000346112	0.909	Solute carrier family 12 member 6
7	9606.ENSP00000324890	0.908	T-cell-specific surface glycoprotein CD28
8	9606.ENSP00000264246	0.900	T-lymphocyte activation antigen CD80
9	9606.ENSP00000332049	0.900	T-lymphocyte activation antigen CD86
10	9606.ENSP00000246914	0.850	Serine/threonine-protein kinase WNK4
11	9606.ENSP00000402152	0.840	Solute carrier family 12 member 3
12	9606.ENSP00000064780	0.831	Tumor necrosis factor receptor superfamily member 19L
13	9606.ENSP00000341292	0.797	Serine/threonine-protein kinase WNK1
14	9606.ENSP00000264930	0.791	Solute carrier family 12 member 7
15	9606.ENSP00000387694	0.787	Solute carrier family 12 member 5
16	9606.ENSP00000346667	0.784	Serine/threonine-protein kinase WNK3
17	9606.ENSP00000329933	0.770	PHD finger protein 12
18	9606.ENSP00000297954	0.764	Serine/threonine-protein kinase WNK2
19	9606.ENSP00000312397	0.763	Kelch-like protein 3
20	9606.ENSP00000395983	0.750	Solute carrier family 12 member 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0019899	0.688	enzyme binding
GO:0019900	0.451	kinase binding
GO:0019901	0.434	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0048583	0.982	regulation of response to stimulus
GO:0050896	0.977	response to stimulus
GO:0034762	0.975	regulation of transmembrane transport
GO:0018107	0.975	peptidyl-threonine phosphorylation
GO:0043266	0.973	regulation of potassium ion transport
GO:0071470	0.972	cellular response to osmotic stress
GO:0048519	0.970	negative regulation of biological process
GO:0034765	0.969	regulation of monoatomic ion transmembrane transport
GO:0032412	0.969	regulation of monoatomic ion transmembrane transporter activity
GO:0048518	0.967	positive regulation of biological process
GO:1904063	0.959	negative regulation of cation transmembrane transport
GO:0032410	0.958	negative regulation of transporter activity
GO:0043267	0.954	negative regulation of potassium ion transport
GO:1901379	0.948	regulation of potassium ion transmembrane transport
GO:0032413	0.945	negative regulation of ion transmembrane transporter activity
GO:0006971	0.932	hypotonic response
GO:0007154	0.927	cell communication
GO:1901016	0.922	regulation of potassium ion transmembrane transporter activity
GO:0032101	0.916	regulation of response to external stimulus
GO:0048522	0.905	positive regulation of cellular process
GO:0023052	0.899	signaling
GO:0046777	0.899	protein autophosphorylation
GO:0040012	0.877	regulation of locomotion
GO:0010646	0.859	regulation of cell communication
GO:0023051	0.856	regulation of signaling
GO:0009966	0.847	regulation of signal transduction
GO:0035556	0.833	intracellular signal transduction
GO:1990868	0.830	response to chemokine
GO:0048584	0.826	positive regulation of response to stimulus
GO:1902531	0.819	regulation of intracellular signal transduction
GO:1990869	0.788	cellular response to chemokine
GO:1900744	0.738	regulation of p38MAPK cascade
GO:0050921	0.737	positive regulation of chemotaxis
GO:0002687	0.731	positive regulation of leukocyte migration
GO:0071675	0.728	regulation of mononuclear cell migration
GO:0002688	0.727	regulation of leukocyte chemotaxis
GO:0043410	0.725	positive regulation of MAPK cascade
GO:2000403	0.703	positive regulation of lymphocyte migration
GO:2000404	0.692	regulation of T cell migration
GO:0032874	0.680	positive regulation of stress-activated MAPK cascade
GO:0051179	0.661	localization
GO:0018105	0.643	peptidyl-serine phosphorylation
GO:0032501	0.488	multicellular organismal process
GO:0006810	0.446	transport
GO:0019222	0.404	regulation of metabolic process
GO:0007166	0.384	cell surface receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0005829	0.984	cytosol
GO:0016020	0.972	membrane
GO:0043226	0.947	organelle
GO:0043229	0.926	intracellular organelle
GO:0043227	0.918	membrane-bounded organelle
GO:0005886	0.837	plasma membrane
GO:0005634	0.823	nucleus
GO:0070013	0.734	intracellular organelle lumen
GO:0005654	0.626	nucleoplasm
GO:0031982	0.370	vesicle
GO:0070062	0.325	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]