StarFunc result for job id Q9UF02

User Input

>input (275 residues)
MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVIVPQNQSTEIKMSLHSGLWR
VCFLAGEERGRCFTIEYVMPMNTQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILNNI
GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAETYFNYKYGWSFA
FAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWVRG
RSPSDISSEASLQMNSNYPALLKCPDYDQMSSSPC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8VHW8	0.897	0.897	1.222E-42	275	0.967	0.967	Q8VHW8.pdb.gz	CCG5_RAT Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1
2	AFDB:P62955	0.719	0.719	1.923E-32	275	0.705	0.705	P62955.pdb.gz	CCG7_HUMAN Voltage-dependent calcium channel gamma-7 subunit OS=Homo sapiens OX=9606 GN=CACNG7 PE=1 SV=1
3	PDB:7rz4A	0.678	0.193	2.148E-27	993	0.698	0.193	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
4	AFDB:O60359	0.589	0.517	7.343E-17	315	0.287	0.251	O60359.pdb.gz	CCG3_HUMAN Voltage-dependent calcium channel gamma-3 subunit OS=Homo sapiens OX=9606 GN=CACNG3 PE=2 SV=1
5	AFDB:O88602	0.588	0.504	1.801E-16	323	0.291	0.248	O88602.pdb.gz	CCG2_MOUSE Voltage-dependent calcium channel gamma-2 subunit OS=Mus musculus OX=10090 GN=Cacng2 PE=1 SV=1
6	AFDB:Q6PFS3	0.607	0.521	2.001E-16	324	0.295	0.250	Q6PFS3.pdb.gz	Q6PFS3_DANRE Voltage-dependent calcium channel gamma-2 subunit OS=Danio rerio OX=7955 GN=cacng2 PE=2 SV=1
7	AFDB:Q8VHW9	0.591	0.502	1.410E-15	327	0.298	0.251	Q8VHW9.pdb.gz	CCG4_RAT Voltage-dependent calcium channel gamma-4 subunit OS=Rattus norvegicus OX=10116 GN=Cacng4 PE=1 SV=1
8	AFDB:Q8WXS5	0.591	0.396	1.226E-14	425	0.295	0.191	Q8WXS5.pdb.gz	CCG8_HUMAN Voltage-dependent calcium channel gamma-8 subunit OS=Homo sapiens OX=9606 GN=CACNG8 PE=2 SV=3
9	AFDB:G5EDT2	0.636	0.486	1.208E-12	366	0.218	0.164	G5EDT2.pdb.gz	G5EDT2_CAEEL STarGazin (Mammalian calcium channel) homolog OS=Caenorhabditis elegans OX=6239 GN=stg-1 PE=2 SV=1
10	AFDB:Q9VRE6	0.651	0.416	2.399E-12	447	0.193	0.119	Q9VRE6.pdb.gz	Q9VRE6_DROME GH12419p1 OS=Drosophila melanogaster OX=7227 GN=stg1 PE=2 SV=3
11	AFDB:B1AQL3	0.598	0.766	2.810E-12	211	0.175	0.227	B1AQL3.pdb.gz	TM235_MOUSE Transmembrane protein 235 OS=Mus musculus OX=10090 GN=Tmem235 PE=1 SV=3
12	PDB:7ocaI	0.551	0.803	4.839E-12	185	0.211	0.314	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
13	PDB:5weoA	0.537	0.161	1.088E-10	988	0.247	0.069	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
14	PDB:5kbtA	0.490	0.155	5.693E-9	973	0.233	0.066	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
15	PDB:6ov2A	0.522	0.761	3.678E-7	182	0.095	0.143	6ov2A.pdb.gz
16	PDB:5b2gC	0.514	0.412	5.047E-7	350	0.102	0.080	5b2gC.pdb.gz
17	PDB:7rzaA	0.526	0.161	1.114E-6	981	0.142	0.040	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
18	PDB:6jp5E	0.473	0.749	1.238E-6	169	0.156	0.254	6jp5E.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
19	PDB:7d3eB	0.349	0.352	1.135E-5	272	0.087	0.088	7d3eB.pdb.gz	Structures of human dual oxidase 1 complex in low-calcium and high-calcium states.
20	PDB:6wxuB	0.375	0.376	6.475E-5	273	0.095	0.095	6wxuB.pdb.gz	Structures of mouse DUOX1-DUOXA1 provide mechanistic insights into enzyme activation and regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8VHW8	0.0	559	275	0.967	0.967	CCG5_RAT Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1
2	Q9UF02	0.0	570	275	1.000	1.000	CCG5_HUMAN Voltage-dependent calcium channel gamma-5 subunit OS=Homo sapiens OX=9606 GN=CACNG5 PE=2 SV=2
3	P62955	4.21e-151	424	275	0.705	0.705	CCG7_HUMAN Voltage-dependent calcium channel gamma-7 subunit OS=Homo sapiens OX=9606 GN=CACNG7 PE=1 SV=1
4	P62956	4.21e-151	424	275	0.705	0.705	CCG7_MOUSE Voltage-dependent calcium channel gamma-7 subunit OS=Mus musculus OX=10090 GN=Cacng7 PE=1 SV=1
5	P62957	4.21e-151	424	275	0.705	0.705	CCG7_RAT Voltage-dependent calcium channel gamma-7 subunit OS=Rattus norvegicus OX=10116 GN=Cacng7 PE=1 SV=1
6	Q6PFS3	1.30e-32	124	324	0.244	0.207	Q6PFS3_DANRE Voltage-dependent calcium channel gamma-2 subunit OS=Danio rerio OX=7955 GN=cacng2 PE=2 SV=1
7	O88602	2.61e-32	123	323	0.247	0.211	CCG2_MOUSE Voltage-dependent calcium channel gamma-2 subunit OS=Mus musculus OX=10090 GN=Cacng2 PE=1 SV=1
8	Q71RJ2	2.61e-32	123	323	0.247	0.211	CCG2_RAT Voltage-dependent calcium channel gamma-2 subunit OS=Rattus norvegicus OX=10116 GN=Cacng2 PE=1 SV=1
9	Q9Y698	2.99e-32	122	323	0.247	0.211	CCG2_HUMAN Voltage-dependent calcium channel gamma-2 subunit OS=Homo sapiens OX=9606 GN=CACNG2 PE=1 SV=1
10	Q8VHW5	7.07e-32	124	421	0.258	0.169	CCG8_RAT Voltage-dependent calcium channel gamma-8 subunit OS=Rattus norvegicus OX=10116 GN=Cacng8 PE=1 SV=1
11	Q8VHW2	9.29e-32	123	423	0.258	0.168	CCG8_MOUSE Voltage-dependent calcium channel gamma-8 subunit OS=Mus musculus OX=10090 GN=Cacng8 PE=1 SV=1
12	Q9JJV4	1.97e-31	120	327	0.251	0.211	CCG4_MOUSE Voltage-dependent calcium channel gamma-4 subunit OS=Mus musculus OX=10090 GN=Cacng4 PE=1 SV=1
13	Q8VHX0	1.98e-31	120	315	0.244	0.213	CCG3_RAT Voltage-dependent calcium channel gamma-3 subunit OS=Rattus norvegicus OX=10116 GN=Cacng3 PE=1 SV=1
14	Q9JJV5	1.98e-31	120	315	0.244	0.213	CCG3_MOUSE Voltage-dependent calcium channel gamma-3 subunit OS=Mus musculus OX=10090 GN=Cacng3 PE=1 SV=2
15	O60359	2.20e-31	120	315	0.244	0.213	CCG3_HUMAN Voltage-dependent calcium channel gamma-3 subunit OS=Homo sapiens OX=9606 GN=CACNG3 PE=2 SV=1
16	Q8WXS5	4.11e-31	121	425	0.244	0.158	CCG8_HUMAN Voltage-dependent calcium channel gamma-8 subunit OS=Homo sapiens OX=9606 GN=CACNG8 PE=2 SV=3
17	Q8VHW9	5.87e-31	119	327	0.247	0.208	CCG4_RAT Voltage-dependent calcium channel gamma-4 subunit OS=Rattus norvegicus OX=10116 GN=Cacng4 PE=1 SV=1
18	Q9UBN1	6.59e-31	119	327	0.247	0.208	CCG4_HUMAN Voltage-dependent calcium channel gamma-4 subunit OS=Homo sapiens OX=9606 GN=CACNG4 PE=1 SV=1
19	Q9VRE6	2.02e-10	62.8	447	0.207	0.128	Q9VRE6_DROME GH12419p1 OS=Drosophila melanogaster OX=7227 GN=stg1 PE=2 SV=3
20	G5EDT2	7.25e-08	55.1	366	0.200	0.150	G5EDT2_CAEEL STarGazin (Mammalian calcium channel) homolog OS=Caenorhabditis elegans OX=6239 GN=stg-1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05931 AgrD	4.9e+02	12.2	Staphylococcal AgrD protein
2	PF13903 Claudin_2	2.1e-18	78.3	PMP-22/EMP/MP20/Claudin tight junction
3	PF08507 COPI_assoc	58	15.2	COPI associated protein
4	PF19862 DUF6336	1.7e+02	13.9	Family of unknown function (DUF6336)
5	PF04819 DUF716	1.4e+02	13.5	Family of unknown function (DUF716)
6	PF00822 PMP22_Claudin	2.1e-19	81.5	PMP-22/EMP/MP20/Claudin family
7	PF06687 SUR7	27	15.8	SUR7/PalI family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000436836

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000282499	0.836	Glutamate receptor 4
2	9606.ENSP00000226021	0.815	Voltage-dependent calcium channel gamma-1 subunit
3	9606.ENSP00000481554	0.815	Glutamate receptor 3
4	9606.ENSP00000296526	0.814	Glutamate receptor 2
5	9606.ENSP00000428994	0.807	Glutamate receptor 1
6	9606.ENSP00000379818	0.792	Glutamate receptor ionotropic, NMDA 2A
7	9606.ENSP00000005284	0.790	Voltage-dependent calcium channel gamma-3 subunit
8	9606.ENSP00000477455	0.787	Glutamate receptor ionotropic, NMDA 2B
9	9606.ENSP00000262138	0.784	Voltage-dependent calcium channel gamma-4 subunit
10	9606.ENSP00000263269	0.783	Glutamate receptor ionotropic, NMDA 2D
11	9606.ENSP00000270458	0.780	Voltage-dependent calcium channel gamma-8 subunit
12	9606.ENSP00000234389	0.779	Glutamate receptor ionotropic, NMDA 3B
13	9606.ENSP00000293190	0.779	Glutamate receptor ionotropic, NMDA 2C
14	9606.ENSP00000355155	0.779	Glutamate receptor ionotropic, NMDA 3A
15	9606.ENSP00000310003	0.777	Protein cornichon homolog 2
16	9606.ENSP00000300105	0.774	Voltage-dependent calcium channel gamma-2 subunit
17	9606.ENSP00000272133	0.765	Protein cornichon homolog 3
18	9606.ENSP00000375647	0.759	Voltage-dependent calcium channel gamma-7 subunit
19	9606.ENSP00000360608	0.758	Glutamate receptor ionotropic, NMDA 1
20	9606.ENSP00000264833	0.738	Noelin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005215	0.892	transporter activity
GO:0015075	0.856	monoatomic ion transmembrane transporter activity
GO:0022890	0.835	inorganic cation transmembrane transporter activity
GO:0022803	0.817	passive transmembrane transporter activity
GO:0008324	0.793	monoatomic cation transmembrane transporter activity
GO:0046873	0.760	metal ion transmembrane transporter activity
GO:0005216	0.586	monoatomic ion channel activity
GO:0022836	0.584	gated channel activity
GO:0005261	0.468	monoatomic cation channel activity
GO:0022839	0.424	monoatomic ion gated channel activity
GO:0098772	0.412	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0010469	0.985	regulation of signaling receptor activity
GO:0099601	0.907	regulation of neurotransmitter receptor activity
GO:0032409	0.904	regulation of transporter activity
GO:0034762	0.874	regulation of transmembrane transport
GO:0032412	0.834	regulation of monoatomic ion transmembrane transporter activity
GO:0009987	0.819	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.998	protein-containing complex
GO:0043226	0.996	organelle
GO:0030054	0.995	cell junction
GO:0034702	0.991	ion channel complex
GO:0098797	0.990	plasma membrane protein complex
GO:0045202	0.972	synapse
GO:0005622	0.933	intracellular anatomical structure
GO:0043227	0.883	membrane-bounded organelle
GO:0098978	0.869	glutamatergic synapse
GO:0098878	0.869	neurotransmitter receptor complex
GO:0043231	0.866	intracellular membrane-bounded organelle
GO:0005737	0.852	cytoplasm
GO:0098794	0.810	postsynapse
GO:0008328	0.810	ionotropic glutamate receptor complex
GO:0032281	0.786	AMPA glutamate receptor complex
GO:0098590	0.722	plasma membrane region
GO:0034703	0.659	cation channel complex
GO:0031982	0.635	vesicle
GO:0097060	0.596	synaptic membrane
GO:0045211	0.442	postsynaptic membrane
GO:0099572	0.433	postsynaptic specialization
GO:0014069	0.392	postsynaptic density
GO:0012505	0.369	endomembrane system
GO:0042383	0.352	sarcolemma
GO:0031981	0.335	nuclear lumen
GO:0034704	0.312	calcium channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]