StarFunc result for job id Q9UF12

User Input

>input (536 residues)
MSPRVVSNSSVLASQSVGITNVRTVFSNVFNNTTAFPILRGSNCHKITAPGLGKGQLVNL
LPPENLPWCGGSQGPRMLRTCYVLCSQAGPPSRGWQSLSFDGGAFHLKGTGELTRALLVL
RLCAWPPLVTHGLLLQAWSRRLLGSRLSGAFLRASVYGQFVAGETAEEVKGCVQQLRTLS
LRPLLAVPTEEEPDSAAKSGEAWYEGNLGAMLRCVDLSRGLLEPPSLAEASLMQLKVTAL
TSTRLCKELASWVRRPGASLELSPERLAEAMDSGQNLQVSCLNAEQNQHLRASLSRLHRV
AQYARAQHVRLLVDAEYTSLNPALSLLVAALAVRWNSPGEGGPWVWNTYQACLKDTFERL
GRDAEAAHRAGLAFGVKLVRGAYLDKERAVAQLHGMEDPTQPDYEATSQSYSRCLELMLT
HVARHGPMCHLMVASHNEESVRQATKRMWELGIPLDGTVCFGQLLGMCDHVSLALGQAGY
VVYKSIPYGSLEEVIPYLIRRAQENRSVLQGARREQELLSQELWRRLLPGCRRIPH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UF12	1.000	1.000	8.166E-85	536	1.000	1.000	Q9UF12.pdb.gz	HYPDH_HUMAN Hydroxyproline dehydrogenase OS=Homo sapiens OX=9606 GN=PRODH2 PE=1 SV=2
2	AFDB:Q8VCZ9	0.816	0.959	1.592E-62	456	0.679	0.798	Q8VCZ9.pdb.gz	HYPDH_MOUSE Hydroxyproline dehydrogenase OS=Mus musculus OX=10090 GN=Prodh2 PE=1 SV=1
3	AFDB:A0A087WWM6	0.694	0.623	8.310E-32	600	0.351	0.313	A0A087WWM6.pdb.gz	A0A087WWM6_HUMAN Proline dehydrogenase OS=Homo sapiens OX=9606 GN=PRODH PE=1 SV=1
4	AFDB:Q04499	0.708	0.563	1.267E-31	681	0.340	0.267	Q04499.pdb.gz	PROD_DROME Proline dehydrogenase 1, mitochondrial OS=Drosophila melanogaster OX=7227 GN=slgA PE=1 SV=2
5	AFDB:F1MAR6	0.700	0.629	1.320E-30	599	0.349	0.312	F1MAR6.pdb.gz	F1MAR6_RAT Proline dehydrogenase OS=Rattus norvegicus OX=10116 GN=Prodh PE=1 SV=3
6	AFDB:P92983	0.716	0.767	1.790E-26	499	0.252	0.271	P92983.pdb.gz	PROD1_ARATH Proline dehydrogenase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=POX1 PE=1 SV=2
7	AFDB:Q57U33	0.702	0.678	3.273E-25	556	0.250	0.241	Q57U33.pdb.gz	Q57U33_TRYB2 Proline dehydrogenase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.8P12.290 PE=3 SV=1
8	AFDB:Q6NKX1	0.722	0.809	4.138E-25	476	0.233	0.263	Q6NKX1.pdb.gz	PROD2_ARATH Proline dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=POX2 PE=1 SV=1
9	AFDB:Q5BCJ9	0.595	0.662	1.909E-21	478	0.215	0.241	Q5BCJ9.pdb.gz	Q5BCJ9_EMENI Proline dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=prnD PE=3 SV=1
10	PDB:2g37B	0.448	0.769	4.128E-12	300	0.147	0.263	2g37B.pdb.gz	Structure and Kinetics of Monofunctional Proline Dehydrogenase from Thermus thermophilus.
11	PDB:4h6qA	0.448	0.815	4.980E-12	281	0.118	0.224	4h6qA.pdb.gz	Crystal structures and kinetics of monofunctional proline dehydrogenase provide insight into substrate recognition and conformational changes associated with flavin reduction and product release.
12	PDB:3hazA	0.489	0.281	5.936E-10	983	0.162	0.089	3hazA.pdb.gz	Crystal structure of the bifunctional proline utilization A flavoenzyme from Bradyrhizobium japonicum
13	PDB:7f3aA	0.203	0.222	1.598E-2	477	0.063	0.071	7f3aA.pdb.gz
14	PDB:6ofuB	0.229	0.402	2.020E-2	264	0.063	0.129	6ofuB.pdb.gz	Structural and Functional Characterization of YdjI, an Aldolase of Unknown Specificity inEscherichia coliK12.
15	PDB:4lv4A	0.270	0.403	2.325E-2	320	0.086	0.144	4lv4A.pdb.gz	A Noncompetitive Inhibitor for Mycobacterium tuberculosis's Class IIa Fructose 1,6-Bisphosphate Aldolase.
16	PDB:3okaA	0.120	0.157	2.804E-2	378	0.095	0.135	3okaA.pdb.gz	Acceptor substrate discrimination in phosphatidyl-myo-inositol mannoside synthesis: structural and mutational analysis of mannosyltransferase Corynebacterium glutamicum PimB'.
17	PDB:4delA	0.280	0.396	3.228E-2	345	0.091	0.142	4delA.pdb.gz	Active site loop dynamics of a class IIa fructose 1,6-bisphosphate aldolase from Mycobacterium tuberculosis.
18	PDB:1gvfB	0.237	0.399	3.382E-2	275	0.082	0.160	1gvfB.pdb.gz	Structure of Tagatose-1,6-Bisphosphate Aldolase; Insight Into Chiral Discrimination, Mechanism and Specificity of Class II Aldolases
19	PDB:7reqB	0.248	0.222	3.382E-2	623	0.091	0.079	7reqB.pdb.gz	Crystal structure of substrate complexes of methylmalonyl-CoA mutase.
20	AFDB:Q8RXN3	0.103	0.123	4.162E-2	408	0.110	0.145	Q8RXN3.pdb.gz	PPT1_ARATH Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPT1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8VCZ9	0.0	691	456	0.683	0.803	HYPDH_MOUSE Hydroxyproline dehydrogenase OS=Mus musculus OX=10090 GN=Prodh2 PE=1 SV=1
2	Q9UF12	0.0	1088	536	1.000	1.000	HYPDH_HUMAN Hydroxyproline dehydrogenase OS=Homo sapiens OX=9606 GN=PRODH2 PE=1 SV=2
3	A0A0G2K2S1	5.64e-69	233	538	0.239	0.238	A0A0G2K2S1_RAT Proline dehydrogenase OS=Rattus norvegicus OX=10116 GN=Prodh PE=1 SV=2
4	F1MAR6	1.88e-68	233	599	0.228	0.204	F1MAR6_RAT Proline dehydrogenase OS=Rattus norvegicus OX=10116 GN=Prodh PE=1 SV=3
5	Q9WU79	8.69e-68	231	599	0.224	0.200	PROD_MOUSE Proline dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Prodh PE=1 SV=2
6	Q04499	6.31e-63	220	681	0.209	0.164	PROD_DROME Proline dehydrogenase 1, mitochondrial OS=Drosophila melanogaster OX=7227 GN=slgA PE=1 SV=2
7	E7EQL6	3.23e-62	214	492	0.215	0.234	E7EQL6_HUMAN Proline dehydrogenase OS=Homo sapiens OX=9606 GN=PRODH PE=1 SV=1
8	O43272	2.46e-61	214	600	0.215	0.192	PROD_HUMAN Proline dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PRODH PE=1 SV=3
9	A0A087WWM6	3.68e-61	213	600	0.215	0.192	A0A087WWM6_HUMAN Proline dehydrogenase OS=Homo sapiens OX=9606 GN=PRODH PE=1 SV=1
10	P92983	2.88e-40	154	499	0.237	0.255	PROD1_ARATH Proline dehydrogenase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=POX1 PE=1 SV=2
11	Q6NKX1	9.18e-40	152	476	0.229	0.258	PROD2_ARATH Proline dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=POX2 PE=1 SV=1
12	Q57U33	3.75e-34	138	556	0.162	0.156	Q57U33_TRYB2 Proline dehydrogenase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.8P12.290 PE=3 SV=1
13	Q5BCJ9	2.40e-21	99.4	478	0.153	0.172	Q5BCJ9_EMENI Proline dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=prnD PE=3 SV=1
14	A0A1D8PNH4	5.23e-15	79.7	489	0.119	0.131	A0A1D8PNH4_CANAL Proline dehydrogenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PUT1 PE=3 SV=1
15	P09368	1.39e-12	72.0	476	0.123	0.139	PUT1_YEAST Proline dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUT1 PE=1 SV=2
16	Q89E26	0.002	43.1	999	0.118	0.063	Q89E26_BRADU Bifunctional protein PutA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110) OX=224911 GN=putA PE=1 SV=1
17	Q9I5F6	0.015	40.8	1060	0.073	0.037	Q9I5F6_PSEAE Bifunctional protein PutA OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=putA PE=3 SV=1
18	P94390	0.30	35.8	303	0.060	0.106	PROD2_BACSU Proline dehydrogenase 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=putB PE=1 SV=1
19	P10503	0.33	36.2	1320	0.116	0.047	PUTA_SALTY Bifunctional protein PutA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=putA PE=2 SV=4
20	P09546	0.39	36.2	1320	0.106	0.043	PUTA_ECOLI Bifunctional protein PutA OS=Escherichia coli (strain K12) OX=83333 GN=putA PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18407 GNAT_like	4.9e+02	12.5	GCN5-related N-acetyltransferase like domain
2	PF01619 Pro_dh	2.5e-61	219.3	Proline dehydrogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301175

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364490	0.982	Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
2	9606.ENSP00000263556	0.900	Prolyl 4-hydroxylase subunit alpha-1
3	9606.ENSP00000384999	0.900	Prolyl 4-hydroxylase subunit alpha-2
4	9606.ENSP00000342502	0.877	Pyrroline-5-carboxylate reductase 2
5	9606.ENSP00000384949	0.856	Pyrroline-5-carboxylate reductase 1, mitochondrial
6	9606.ENSP00000220966	0.848	Pyrroline-5-carboxylate reductase 3
7	9606.ENSP00000263202	0.798	Ubiquitin recognition factor in ER-associated degradation protein 1
8	9606.ENSP00000360268	0.782	Delta-1-pyrroline-5-carboxylate synthase
9	9606.ENSP00000353732	0.736	CAP-Gly domain-containing linker protein 3
10	9606.ENSP00000466989	0.735	Leucine-rich repeat and fibronectin type-III domain-containing protein 3
11	9606.ENSP00000331313	0.731	G protein subunit beta 1 like
12	9606.ENSP00000265881	0.724	Oligoribonuclease, mitochondrial
13	9606.ENSP00000324124	0.716	DNA-directed RNA polymerases I, II, and III subunit RPABC5
14	9606.ENSP00000404232	0.680	EF-hand domain-containing family member C2
15	9606.ENSP00000380109	0.674	NF-kappa-B inhibitor delta
16	9606.ENSP00000357838	0.638	Ornithine aminotransferase, mitochondrial
17	9606.ENSP00000354511	0.629	Catechol O-methyltransferase
18	9606.ENSP00000360690	0.628	LON peptidase N-terminal domain and ring finger 3
19	9606.ENSP00000280358	0.624	Testis-expressed protein 12
20	9606.ENSP00000391311	0.615	Septin-5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004657	1.000	proline dehydrogenase activity
GO:0005488	0.897	binding
GO:0005515	0.796	protein binding
GO:0097159	0.525	organic cyclic compound binding
GO:1901363	0.504	heterocyclic compound binding
GO:0043167	0.370	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0006807	0.981	nitrogen compound metabolic process
GO:0009063	0.973	amino acid catabolic process
GO:0009064	0.971	glutamine family amino acid metabolic process
GO:1901606	0.971	alpha-amino acid catabolic process
GO:0006560	0.964	proline metabolic process
GO:0009065	0.946	glutamine family amino acid catabolic process
GO:0065007	0.338	biological regulation
GO:0050789	0.317	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005739	0.999	mitochondrion
GO:0031966	0.987	mitochondrial membrane
GO:0005743	0.978	mitochondrial inner membrane
GO:0070013	0.736	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23784	1.000	a quinone + L-proline = (S)-1-pyrroline-5-carboxylate + a quinol + H(+)
EC:1.5.5.2	1.000	proline dehydrogenase.

[back to server]