StarFunc result for job id Q9UF33

User Input

>input (1036 residues)
MGGCEVREFLLQFGFFLPLLTAWPGDCSHVSNNQVVLLDTTTVLGELGWKTYPLNGWDAI
TEMDEHNRPIHTYQVCNVMEPNQNNWLRTNWISRDAAQKIYVEMKFTLRDCNSIPWVLGT
CKETFNLFYMESDESHGIKFKPNQYTKIDTIAADESFTQMDLGDRILKLNTEIREVGPIE
RKGFYLAFQDIGACIALVSVRVFYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSA
EERDTPKLYCGADGDWLVPLGRCICSTGYEEIEGSCHACRPGFYKAFAGNTKCSKCPPHS
LTYMEATSVCQCEKGYFRAEKDPPSMACTRPPSAPRNVVFNINETALILEWSPPSDTGGR
KDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGLINNSVIVLDFVSHVNYTFEIEAMNG
VSELSFSPKPFTAITVTTDQDAPSLIGVVRKDWASQNSIALSWQAPAFSNGAILDYEIKY
YEKEHEQLTYSSTRSKAPSVIITGLKPATKYVFHIRVRTATGYSGYSQKFEFETGDETSD
MAAEQGQILVIATAAVGGFTLLVILTLFFLITGRCQWYIKAKMKSEEKRRNHLQNGHLRF
PGIKTYIDPDTYEDPSLAVHEFAKEIDPSRIRIERVIGAGEFGEVCSGRLKTPGKREIPV
AIKTLKGGHMDRQRRDFLREASIMGQFDHPNIIRLEGVVTKRSFPAIGVEAFCPSFLRAG
FLNSIQAPHPVPGGGSLPPRIPAGRPVMIVVEYMENGSLDSFLRKHDGHFTVIQLVGMLR
GIASGMKYLSDMGYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEAAYTTTGGKIPI
RWTAPEAIAYRKFSSASDAWSYGIVMWEVMSYGERPYWEMSNQDVILSIEEGYRLPAPMG
CPASLHQLMLHCWQKERNHRPKFTDIVSFLDKLIRNPSALHTLVEDILVMPESPGEVPEY
PLFVTVGDWLDSIKMGQYKNNFVAAGFTTFDLISRMSIDDIRRIGVILIGHQRRIVSSIQ
TLRLHMMHIQEKGFHV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B4J1T8	0.775	0.717	0.000	1130	1.000	0.917	A0A0B4J1T8.pdb.gz	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	AFDB:A0A0G2JY48	0.407	0.426	0.000	986	0.512	0.538	A0A0G2JY48.pdb.gz	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	AFDB:A0A3B3IRY8	0.394	0.388	0.000	1055	0.490	0.482	A0A3B3IRY8.pdb.gz	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
4	AFDB:D3ZDH4	0.343	0.362	0.000	977	0.406	0.431	D3ZDH4.pdb.gz	D3ZDH4_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha1 PE=1 SV=1
5	AFDB:F1Q9D9	0.405	0.434	0.000	963	0.569	0.612	F1Q9D9.pdb.gz
6	AFDB:F1RCL1	0.400	0.422	0.000	976	0.560	0.594	F1RCL1.pdb.gz
7	AFDB:O08680	0.381	0.399	0.000	984	0.591	0.622	O08680.pdb.gz	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
8	AFDB:O15197	0.495	0.501	0.000	1021	0.387	0.393	O15197.pdb.gz	EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4
9	AFDB:O73875	0.428	0.447	0.000	987	0.453	0.475	O73875.pdb.gz	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
10	AFDB:O73878	0.407	0.428	0.000	976	0.451	0.478	O73878.pdb.gz	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
11	PDB:2h8hA	0.228	0.504	2.315E-20	445	0.128	0.299	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:1k9aB	0.236	0.542	7.202E-20	441	0.098	0.231	1k9aB.pdb.gz
13	PDB:4fl2A	0.233	0.425	1.750E-19	555	0.101	0.189	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.237	0.434	3.918E-18	551	0.099	0.187	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:8dksA	0.205	0.682	5.354E-14	283	0.065	0.237	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:6b1uA	0.226	0.503	2.866E-13	442	0.069	0.161	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
17	PDB:5ufuA	0.228	0.604	3.667E-13	369	0.069	0.195	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
18	PDB:6lk5A	0.224	0.812	4.931E-13	265	0.057	0.223	6lk5A.pdb.gz
19	PDB:4rerA	0.224	0.482	5.180E-13	459	0.078	0.176	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
20	PDB:2qkwB	0.219	0.711	5.717E-13	292	0.068	0.240	2qkwB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J1T8	2165	1130	1.000	0.917	A0A0B4J1T8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
2	A0A0G2JY48	1037	965	0.508	0.545	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
3	A0A140VJJ0	1308	983	0.599	0.632	A0A140VJJ0_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=2 SV=1
4	A0A3B3IRY8	1061	1055	0.506	0.497	A0A3B3IRY8_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB1 PE=1 SV=1
5	B1AKC9	1065	946	0.505	0.553	B1AKC9_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=1
6	B2B9B0	1093	986	0.517	0.544	B2B9B0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=2 SV=1
7	C9JXA2	1264	918	0.576	0.650	C9JXA2_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EPHA3 PE=1 SV=1
8	D1YSF9	647	1005	0.376	0.388	D1YSF9_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Eph PE=4 SV=1
9	D3ZDH4	756	977	0.413	0.438	D3ZDH4_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha1 PE=1 SV=1
10	D3ZZK3	1200	949	0.568	0.620	D3ZZK3_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha4 PE=4 SV=2
11	E7EU71	936	547	0.426	0.806	E7EU71_HUMAN EPH receptor A6 OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
12	F1MAJ0	1088	987	0.519	0.545	F1MAJ0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=4
13	H0Y9V0	590	324	0.268	0.858	H0Y9V0_HUMAN EPH receptor A6 (Fragment) OS=Homo sapiens OX=9606 GN=EPHA6 PE=1 SV=1
14	O08644	736	1014	0.393	0.401	EPHB6_MOUSE Ephrin type-B receptor 6 OS=Mus musculus OX=10090 GN=Ephb6 PE=2 SV=4
15	O08680	1298	984	0.597	0.628	EPHA3_RAT Ephrin type-A receptor 3 OS=Rattus norvegicus OX=10116 GN=Epha3 PE=2 SV=1
16	O09127	1152	1004	0.530	0.547	EPHA8_MOUSE Ephrin type-A receptor 8 OS=Mus musculus OX=10090 GN=Epha8 PE=1 SV=2
17	O15197	721	1021	0.389	0.395	EPHB6_HUMAN Ephrin type-B receptor 6 OS=Homo sapiens OX=9606 GN=EPHB6 PE=1 SV=4
18	O73875	857	987	0.451	0.473	EPB4A_DANRE Ephrin type-B receptor 4a OS=Danio rerio OX=7955 GN=ephb4a PE=1 SV=3
19	O73878	873	976	0.461	0.490	EPB4B_DANRE Ephrin type-B receptor 4b OS=Danio rerio OX=7955 GN=ephb4b PE=1 SV=2
20	O96435	647	1019	0.383	0.390	O96435_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Eph PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	1.9e+02	12.6	ABC1 atypical kinase-like domain
2	PF14575 EphA2_TM	7.3e-19	79.6	Ephrin type-A receptor 2 transmembrane domain
3	PF01404 Ephrin_lbd	1.3e-65	232.4	Ephrin receptor ligand binding domain
4	PF07699 Ephrin_rec_like	0.045	24.9	Tyrosine-protein kinase ephrin type A/B receptor-like
5	PF00041 fn3	6.8e-23	92.1	Fibronectin type III domain
6	PF16893 fn3_2	3.1	19.4	Fibronectin type III domain
7	PF12330 Haspin_kinase	2.6e+02	11.9	Haspin like kinase domain
8	PF06293 Kdo	1.9e+02	12.8	Lipopolysaccharide kinase (Kdo/WaaP) family
9	PF00069 Pkinase	2.7e-38	143.4	Protein kinase domain
10	PF07714 PK_Tyr_Ser-Thr	9.4e-89	308.7	Protein tyrosine and serine/threonine kinase
11	PF16656 Pur_ac_phosph_N	0.17	23.9	Purple acid Phosphatase, N-terminal domain
12	PF00536 SAM_1	1.1e-15	69.1	SAM domain (Sterile alpha motif)
13	PF07647 SAM_2	4.2e-13	60.5	SAM domain (Sterile alpha motif)
14	PF14292 SusE	85	14.9	SusE outer membrane protein
15	PF01108 Tissue_fac	29	16.0	Tissue factor
16	PF15086 UPF0542	5e+02	12.0	Uncharacterised protein family UPF0542

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000374323

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328777	0.984	Ephrin-A5
2	9606.ENSP00000215368	0.966	Ephrin-A2
3	9606.ENSP00000400175	0.920	Transforming protein RhoA
4	9606.ENSP00000358309	0.915	Ephrin type-A receptor 7
5	9606.ENSP00000480763	0.914	Ephrin type-A receptor 5
6	9606.ENSP00000281821	0.907	Ephrin type-A receptor 4
7	9606.ENSP00000337451	0.906	Ephrin type-A receptor 3
8	9606.ENSP00000362680	0.905	Proto-oncogene tyrosine-protein kinase Src
9	9606.ENSP00000346671	0.903	Tyrosine-protein kinase Fyn
10	9606.ENSP00000363117	0.903	Tyrosine-protein kinase Fgr
11	9606.ENSP00000428924	0.903	Tyrosine-protein kinase Lyn
12	9606.ENSP00000444986	0.903	Tyrosine-protein kinase HCK
13	9606.ENSP00000462468	0.903	Tyrosine-protein kinase Yes
14	9606.ENSP00000259089	0.902	Tyrosine-protein kinase Blk
15	9606.ENSP00000337825	0.902	Tyrosine-protein kinase Lck
16	9606.ENSP00000419782	0.902	Cyclin-dependent-like kinase 5
17	9606.ENSP00000357392	0.893	Ephrin-A1
18	9606.ENSP00000264051	0.878	Ephexin-1
19	9606.ENSP00000414378	0.859	Ephrin-A4
20	9606.ENSP00000357393	0.847	Ephrin-A3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0060089	1.000	molecular transducer activity
GO:0005515	1.000	protein binding
GO:0004713	1.000	protein tyrosine kinase activity
GO:0038023	0.986	signaling receptor activity
GO:0004888	0.968	transmembrane signaling receptor activity
GO:0019199	0.958	transmembrane receptor protein kinase activity
GO:0004714	0.940	transmembrane receptor protein tyrosine kinase activity
GO:0005003	0.825	ephrin receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050896	0.988	response to stimulus
GO:0050794	0.987	regulation of cellular process
GO:0032501	0.975	multicellular organismal process
GO:0048856	0.945	anatomical structure development
GO:0048731	0.942	system development
GO:0051716	0.925	cellular response to stimulus
GO:0048013	0.903	ephrin receptor signaling pathway
GO:0007399	0.881	nervous system development
GO:0042221	0.699	response to chemical
GO:0071704	0.642	organic substance metabolic process
GO:0050793	0.642	regulation of developmental process
GO:0009653	0.627	anatomical structure morphogenesis
GO:0048518	0.624	positive regulation of biological process
GO:0044238	0.614	primary metabolic process
GO:0006807	0.597	nitrogen compound metabolic process
GO:0048519	0.590	negative regulation of biological process
GO:0044237	0.577	cellular metabolic process
GO:0043170	0.550	macromolecule metabolic process
GO:1901564	0.539	organonitrogen compound metabolic process
GO:0071840	0.522	cellular component organization or biogenesis
GO:0019538	0.505	protein metabolic process
GO:0048523	0.502	negative regulation of cellular process
GO:0043412	0.491	macromolecule modification
GO:0048522	0.476	positive regulation of cellular process
GO:0019222	0.455	regulation of metabolic process
GO:0048583	0.440	regulation of response to stimulus
GO:0051128	0.433	regulation of cellular component organization
GO:0016310	0.420	phosphorylation
GO:0036211	0.420	protein modification process
GO:0006468	0.407	protein phosphorylation
GO:0060255	0.393	regulation of macromolecule metabolic process
GO:0016043	0.358	cellular component organization
GO:0030155	0.351	regulation of cell adhesion
GO:0048870	0.301	cell motility

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	1.000	intracellular anatomical structure
GO:0005886	1.000	plasma membrane
GO:0043226	0.997	organelle
GO:0043229	0.993	intracellular organelle
GO:0043227	0.991	membrane-bounded organelle
GO:0043231	0.979	intracellular membrane-bounded organelle
GO:0070013	0.945	intracellular organelle lumen
GO:0005634	0.933	nucleus
GO:0005654	0.921	nucleoplasm
GO:0005737	0.404	cytoplasm
GO:0012505	0.388	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	1.000	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.1	0.940	receptor protein-tyrosine kinase.

[back to server]