StarFunc result for job id Q9UF56

User Input

>input (701 residues)
MGHLLSKEPRNRPSQKRPRCCSWCRRRRPLLRLPRRTPAKVPPQPAAPRSRDCFFRGPCM
LCFIVHSPGAPAPAGPEEEPPLSPPPRDGAYAAASSSQHLARRYAALAAEDCAAAARRFL
LSSAAAAAAAAASASSPASCCKELGLAAAAAWEQQGRSLFLASLGPVRFLGPPAAVQLFR
GPTPSPAELPTPPEMVCKRKGAGVPACTPCKQPRCGGGGCGGGGGGGGGGGPAGGGASPP
RPPDAGCCQAPEQPPQPLCPPPSSPTSEGAPTEAGGDAVRAGGTAPLSAQQQHECGDADC
RESPENPCDCHREPPPETPDINQLPPSILLKIFSNLSLDERCLSASLVCKYWRDLCLDFQ
FWKQLDLSSRQQVTDELLEKIASRSQNIIEINISDCRSMSDNGVCVLAFKCPGLLRYTAY
RCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYKISDE
GMIVIAKGCLKLQRIYMQENKLVTDQSVKAFAEHCPELQYVGFMGCSVTSKGVIHLTKLR
NLSSLDLRHITELDNETVMEIVKRCKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELYLV
SCKITDYALIAIGRYSMTIETVDVGWCKEITDQGATLIAQSSKSLRYLGLMRCDKVNEVT
VEQLVQQYPHITFSTVLQDCKRTLERAYQMGWTPNMSAASS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UF56	1.000	1.000	0.000	701	1.000	1.000	Q9UF56.pdb.gz	FXL17_HUMAN F-box/LRR-repeat protein 17 OS=Homo sapiens OX=9606 GN=FBXL17 PE=1 SV=3
2	AFDB:Q8BH16	0.459	0.737	2.247E-24	423	0.123	0.203	Q8BH16.pdb.gz	FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus OX=10090 GN=Fbxl2 PE=1 SV=1
3	AFDB:P34284	0.452	0.658	1.146E-23	466	0.141	0.212	P34284.pdb.gz	FBXL_CAEEL F-box/LRR-repeat protein fbxl-1 OS=Caenorhabditis elegans OX=6239 GN=fbxl-1 PE=2 SV=3
4	AFDB:Q96IG2	0.459	0.718	3.698E-23	436	0.120	0.193	Q96IG2.pdb.gz	FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens OX=9606 GN=FBXL20 PE=1 SV=2
5	PDB:6o60C	0.443	0.758	5.503E-23	389	0.116	0.208	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
6	AFDB:Q6NW95	0.211	0.357	2.295E-12	296	0.093	0.220	Q6NW95.pdb.gz	FXL15_DANRE F-box/LRR-repeat protein 15 OS=Danio rerio OX=7955 GN=fbxl15 PE=2 SV=2
7	PDB:3oglB	0.245	0.298	8.988E-12	568	0.103	0.127	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
8	PDB:1a4yA	0.398	0.587	1.743E-11	460	0.106	0.161	1a4yA.pdb.gz
9	PDB:2p1nB	0.246	0.298	2.756E-11	571	0.124	0.152	2p1nB.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
10	PDB:7b5mT	0.243	0.432	7.631E-11	325	0.093	0.200	7b5mT.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
11	PDB:7sa1B	0.286	0.318	2.462E-10	624	0.096	0.107	7sa1B.pdb.gz
12	PDB:4i6jB	0.290	0.452	6.817E-10	394	0.094	0.168	4i6jB.pdb.gz
13	PDB:7pmkL	0.318	0.438	9.736E-10	475	0.100	0.147	7pmkL.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
14	PDB:7pzcA	0.350	0.251	2.696E-9	1010	0.091	0.063	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
15	AFDB:Q9VYW5	0.296	0.210	1.703E-8	1048	0.124	0.083	Q9VYW5.pdb.gz	Q9VYW5_DROME LD23158p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2247 PE=1 SV=1
16	PDB:4kxfP	0.280	0.233	3.620E-8	866	0.084	0.068	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
17	AFDB:P08678	0.231	0.097	2.173E-7	2026	0.146	0.050	P08678.pdb.gz	CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CYR1 PE=1 SV=2
18	AFDB:Q6F5E8	0.339	0.185	1.549E-4	1435	0.110	0.054	Q6F5E8.pdb.gz	CARL2_HUMAN Capping protein, Arp2/3 and myosin-I linker protein 2 OS=Homo sapiens OX=9606 GN=CARMIL2 PE=1 SV=2
19	AFDB:F4IA60	0.141	0.144	7.061E-3	681	0.108	0.112	F4IA60.pdb.gz	F4IA60_ARATH Outer arm dynein light chain 1 protein OS=Arabidopsis thaliana OX=3702 GN=At1g78230 PE=1 SV=1
20	AFDB:Q8IKP1	0.097	0.094	2.938E-2	741	0.091	0.086	Q8IKP1.pdb.gz	Q8IKP1_PLAF7 ATP-dependent RNA helicase DBP5 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1459000 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A6E1XD66	0.0	677	382	0.471	0.864	A0A6E1XD66_HUMAN F-box and leucine rich repeat protein 17 (Fragment) OS=Homo sapiens OX=9606 GN=FBXL17 PE=1 SV=1
2	B1H1X1	0.0	681	673	0.458	0.477	FXL17_XENLA F-box/LRR-repeat protein 17 OS=Xenopus laevis OX=8355 GN=fbxl17 PE=2 SV=1
3	H7C835	0.0	937	463	0.660	1.000	H7C835_HUMAN F-box and leucine-rich repeat protein 17 OS=Homo sapiens OX=9606 GN=FBXL17 PE=2 SV=1
4	Q9UF56	0.0	1431	701	1.000	1.000	FXL17_HUMAN F-box/LRR-repeat protein 17 OS=Homo sapiens OX=9606 GN=FBXL17 PE=1 SV=3
5	C8V4D4	3.28e-38	152	585	0.161	0.193	GRRA_EMENI SCF E3 ubiquitin ligase complex F-box protein grrA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=grrA PE=2 SV=1
6	A8DYA6	6.96e-30	127	651	0.124	0.134	A8DYA6_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=4 SV=1
7	A1Z8M8	2.50e-29	124	464	0.124	0.188	A1Z8M8_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=FBXL2 PE=4 SV=1
8	Q5BI22	4.34e-29	123	437	0.124	0.199	Q5BI22_DROME LD12638p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=2 SV=1
9	A0A0B4KEK4	4.57e-29	123	455	0.124	0.191	A0A0B4KEK4_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=4 SV=1
10	A8DYA5	5.02e-29	122	426	0.124	0.204	A8DYA5_DROME LP16447p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=2 SV=1
11	Q5RH13	5.98e-29	122	400	0.146	0.255	Q5RH13_DANRE F-box and leucine-rich repeat protein 14b OS=Danio rerio OX=7955 GN=fbxl14 PE=2 SV=1
12	A0A0B4KEU4	8.68e-29	123	497	0.124	0.175	A0A0B4KEU4_DROME Uncharacterized protein, isoform F OS=Drosophila melanogaster OX=7227 GN=FBXL2 PE=4 SV=1
13	Q8N1E6	1.87e-28	120	418	0.140	0.234	FXL14_HUMAN F-box/LRR-repeat protein 14 OS=Homo sapiens OX=9606 GN=FBXL14 PE=1 SV=1
14	Q5BJ29	2.55e-28	121	491	0.137	0.196	FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus OX=10090 GN=Fbxl7 PE=1 SV=1
15	Q9UJT9	3.26e-28	121	491	0.137	0.196	FBXL7_HUMAN F-box/LRR-repeat protein 7 OS=Homo sapiens OX=9606 GN=FBXL7 PE=1 SV=1
16	Q6TGX5	4.25e-27	116	411	0.140	0.238	Q6TGX5_DANRE F-box and leucine-rich repeat protein 14a OS=Danio rerio OX=7955 GN=wu:fi25d04 PE=2 SV=1
17	P34284	1.94e-26	115	466	0.134	0.202	FBXL_CAEEL F-box/LRR-repeat protein fbxl-1 OS=Caenorhabditis elegans OX=6239 GN=fbxl-1 PE=2 SV=3
18	Q9C5D2	1.13e-24	111	610	0.124	0.143	FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana OX=3702 GN=FBL4 PE=2 SV=1
19	Q8BH16	3.22e-24	108	423	0.121	0.201	FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus OX=10090 GN=Fbxl2 PE=1 SV=1
20	Q9UKC9	4.10e-23	104	423	0.120	0.199	FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens OX=9606 GN=FBXL2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00646 F-box	0.0032	28.5	F-box domain
2	PF12937 F-box-like	6.6e-09	46.8	F-box-like
3	PF12799 LRR_4	0.079	24.7	Leucine Rich repeats (2 copies)
4	PF13516 LRR_6	2.4e-08	44.4	Leucine Rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000437464

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231487	0.995	S-phase kinase-associated protein 1
2	9606.ENSP00000326804	0.983	Cullin-1
3	9606.ENSP00000171111	0.855	Kelch-like ECH-associated protein 1
4	9606.ENSP00000382805	0.821	Transcription regulator protein BACH1
5	9606.ENSP00000364382	0.751	Thioredoxin-like protein AAED1
6	9606.ENSP00000358918	0.729	Suppressor of fused homolog
7	9606.ENSP00000356301	0.720	Transmembrane protein 9
8	9606.ENSP00000364405	0.714	Zinc finger protein 367
9	9606.ENSP00000424497	0.710	Putative E3 ubiquitin-protein ligase SH3RF2
10	9606.ENSP00000426941	0.704	28S ribosomal protein S27, mitochondrial
11	9606.ENSP00000355827	0.702	F-box only protein 28
12	9606.ENSP00000352314	0.697	Kelch-like protein 14
13	9606.ENSP00000390783	0.690	Sec1 family domain-containing protein 1
14	9606.ENSP00000356230	0.682	Kelch-like protein 12
15	9606.ENSP00000321445	0.676	Musculin
16	9606.ENSP00000423673	0.676	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
17	9606.ENSP00000369335	0.658	F-box DNA helicase 1
18	9606.ENSP00000402935	0.630	TBC1 domain family member 5
19	9606.ENSP00000216225	0.625	E3 ubiquitin-protein ligase RBX1
20	9606.ENSP00000311184	0.624	WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0008152	0.995	metabolic process
GO:0044238	0.993	primary metabolic process
GO:0050794	0.990	regulation of cellular process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0043170	0.985	macromolecule metabolic process
GO:0044237	0.967	cellular metabolic process
GO:0016567	0.956	protein ubiquitination
GO:0009966	0.937	regulation of signal transduction
GO:0044260	0.927	cellular macromolecule metabolic process
GO:0009057	0.916	macromolecule catabolic process
GO:0030163	0.910	protein catabolic process
GO:0010498	0.899	proteasomal protein catabolic process
GO:0006511	0.859	ubiquitin-dependent protein catabolic process
GO:0043161	0.809	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0031146	0.738	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0006515	0.682	protein quality control for misfolded or incompletely synthesized proteins
GO:0008589	0.672	regulation of smoothened signaling pathway
GO:0000209	0.575	protein polyubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.999	cytoplasm
GO:0032991	0.998	protein-containing complex
GO:0031461	0.991	cullin-RING ubiquitin ligase complex
GO:0005829	0.958	cytosol
GO:0019005	0.952	SCF ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]