StarFunc result for job id Q9UFH2

User Input

>input (1400 residues)
MTMAPDVRLEYLEEVASIVLKFKPDKWSKLIGAEENVALFTEFFEKPDVQVLVLTLNAAG
MIIPCLGFPQSLKSKGVYFIKTKSENINKDNYRARLLYGDISPTPVDQLIAVVEEVLSSL
LNQSENMAGWPQVVSEDIVKQVHRLKNEMFVMSGKIKGKTLLPIPEHLGSLDGTLESMER
IPSSLDNLLLHAIETTIIDWSHQIRDVLSKDSAQALLDGLHPLPQVEFEFWDTRLLNLKC
IHEQLNRPKVNKIVEILEKAKSCYWPALQNVYTNVTEGLKEANDIVLYLKPLRILLEEME
QADFTMLPTFIAKVLDTICFIWATSEYYNTPARIIVILQEFCNQIIEMTRTFLSPEEVLK
GLQGEIEEVLSGISLAVNVLKELYQTYDFCCVNMKLFFKDKEPVPWEFPSSLAFSRINSF
FQRIQTIEELYKTAIEFLKLEKIELGGVRGNLLGSLVTRIYDEVFELVKVFADCKYDPLD
PGDSNFDRDYADFEIKIQDLDRRLATIFCQGFDDCSCIKSSAKLLYMCGGLMERPLILAE
VAPRYSVMLELFDAELDNAKILYDAQMAASEEGNIPLIHKNMPPVAGQLKWSLELQERLE
VSMKHLKHVEHPVMSGAEAKLTYQKYDEMMELLRCHREKIYQQWVAGVDQDCHFNLGQPL
ILRDAASNLIHVNFSKALVAVLREVKYLNFQQQKEIPDSAESLFSENETFRKFVGNLELI
VGWYNEIKTIVKAVEFLLIKSELEAIDVKLLSAETTLFWNGEGVFQYIQEVREILHNLQN
RMQKAKQNIEGISQAMKDWSANPLFERKDNKKEALLDLDGRIANLNKRYAAVRDAGVKIQ
AMVAENAELFRADTLSLPWKDYVIYIDDMVLDEFDQFIRKSLSFLMDNMVIDESIAPLFE
IRMELDEDGLTFNPTLEVGSDRGFLALIEGLVNDIYNVARLIPRLAKDRMNYKMDLEDNT
DLIEMREEVSSLVINAMKEAEEYQDSFERYSYLWTDNLQEFMKNFLIYGCAVTAEDLDTW
TDDTIPKTPPTLAQFQEQIDSYEKLYEEVSKCENTKVFHGWLQCDCRPFKQALLSTIRRW
GFMFKRHLSNHVTNSLADLEAFMKVARMGLTKPLKEGDYDGLVEVMGHLMKVKERQAATD
NMFEPLKQTIELLKTYGEEMPEEIHLKLQELPEHWANTKKLAIQVKLTVAPLQANEVSIL
RRKCQQFELKQHEFRERFRREAPFSFSDPNPYKSLNKQQKSISAMEGIMEALSKSGGLFE
VPVPDYKQLKACHREVRLLKELWDMVVVVNTSIEDWKTTKWKDINVEQMDIDCKKFAKDM
RSLDKEMKTWDAFVGLDNTVKNVITSLRAVSELQNPAIRERHWQQLMQATQVKFKMSEET
TLADLLQLNLHSYEDEVRNI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IUQ6	0.414	0.918	6.632E-43	614	0.161	0.368	A0A0R4IUQ6.pdb.gz
2	PDB:7z8fe	0.281	0.111	6.519E-33	4579	0.144	0.044	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
3	AFDB:Q5SX07	0.310	0.913	7.730E-30	457	0.119	0.365	Q5SX07.pdb.gz	Q5SX07_MOUSE Dynein, axonemal, heavy chain 9 OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
4	PDB:7kzmC	0.272	0.117	2.392E-17	3890	0.149	0.054	7kzmC.pdb.gz	Structure of a microtubule-bound axonemal dynein.
5	AFDB:Q9VN30	0.210	0.262	2.344E-11	1079	0.071	0.093	Q9VN30.pdb.gz	Q9VN30_DROME Dynein heavy chain linker domain-containing protein OS=Drosophila melanogaster OX=7227 GN=sac PE=4 SV=3
6	PDB:7z8jf	0.213	0.382	9.213E-11	674	0.069	0.144	7z8jf.pdb.gz
7	AFDB:Q8BXT7	0.117	0.718	3.542E-8	203	0.036	0.246	Q8BXT7.pdb.gz	Q8BXT7_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Dnah9 PE=2 SV=1
8	AFDB:Q8JGN7	0.071	0.485	2.813E-5	202	0.046	0.317	Q8JGN7.pdb.gz
9	AFDB:D6XEJ8	0.150	0.123	4.039E-5	1736	0.048	0.039	D6XEJ8.pdb.gz	D6XEJ8_TRYB2 Flagellar Member 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.10 PE=4 SV=1
10	AFDB:F1R446	0.112	0.074	1.939E-4	2480	0.129	0.073	F1R446.pdb.gz
11	AFDB:P11277	0.107	0.077	3.691E-4	2137	0.133	0.087	P11277.pdb.gz	SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5
12	AFDB:A0A1D8PHX3	0.079	0.057	9.308E-4	2482	0.129	0.073	A0A1D8PHX3.pdb.gz	A0A1D8PHX3_CANAL Serine/threonine-protein kinase TOR OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TOR1 PE=3 SV=1
13	AFDB:Q01082	0.100	0.069	1.050E-3	2364	0.129	0.076	Q01082.pdb.gz	SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2
14	PDB:7owgB	0.064	0.050	1.338E-3	2152	0.136	0.088	7owgB.pdb.gz
15	PDB:7qdrB	0.069	0.074	4.657E-3	1212	0.118	0.136	7qdrB.pdb.gz
16	PDB:4bujB	0.073	0.075	6.425E-3	1367	0.099	0.102	4bujB.pdb.gz
17	PDB:7mp6B	0.077	0.071	1.128E-2	1609	0.129	0.112	7mp6B.pdb.gz
18	PDB:6zwmB	0.061	0.049	1.175E-2	2185	0.121	0.077	6zwmB.pdb.gz	The 3.2- angstrom resolution structure of human mTORC2.
19	PDB:7u9tA	0.062	0.035	1.828E-2	4229	0.119	0.039	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
20	PDB:7ni5A	0.068	0.049	1.981E-2	2791	0.116	0.058	7ni5A.pdb.gz	Molecular basis of human ATM kinase inhibition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KHJ4	0.0	1039	4496	0.396	0.123	A0A0B4KHJ4_DROME Dynein heavy chain at 93AB, isoform C OS=Drosophila melanogaster OX=7227 GN=Dhc93AB PE=3 SV=1
2	B1AR51	0.0	1156	4484	0.419	0.131	B1AR51_MOUSE Dynein, axonemal, heavy chain 9 OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
3	E9Q7N9	0.0	1112	4488	0.409	0.127	E9Q7N9_MOUSE Dynein, axonemal, heavy chain 11 OS=Mus musculus OX=10090 GN=Dnah11 PE=1 SV=2
4	F1SC07	0.0	1111	4518	0.396	0.123	DYH11_PIG Dynein axonemal heavy chain 11 OS=Sus scrofa OX=9823 GN=DNAH11 PE=1 SV=4
5	Q69Z23	0.0	2446	4481	0.843	0.263	DYH17_MOUSE Dynein axonemal heavy chain 17 OS=Mus musculus OX=10090 GN=Dnah17 PE=1 SV=2
6	Q96DT5	0.0	1120	4516	0.397	0.123	DYH11_HUMAN Dynein axonemal heavy chain 11 OS=Homo sapiens OX=9606 GN=DNAH11 PE=1 SV=4
7	Q9NYC9	0.0	1152	4486	0.418	0.130	DYH9_HUMAN Dynein axonemal heavy chain 9 OS=Homo sapiens OX=9606 GN=DNAH9 PE=1 SV=3
8	Q9QZH1	0.0	1115	4488	0.409	0.128	Q9QZH1_MOUSE Left-right dynein OS=Mus musculus OX=10090 GN=Dnah11 PE=2 SV=1
9	Q9UFH2	0.0	2893	4462	1.000	0.314	DYH17_HUMAN Dynein axonemal heavy chain 17 OS=Homo sapiens OX=9606 GN=DNAH17 PE=1 SV=3
10	Q7SY17	1.48e-152	477	614	0.161	0.368	Q7SY17_DANRE Dynein, axonemal, heavy chain 9 OS=Danio rerio OX=7955 GN=Lrdr PE=1 SV=1
11	Q386I6	9.10e-134	460	4658	0.272	0.082	Q386I6_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0760 PE=4 SV=1
12	Q5SX07	1.05e-104	343	457	0.119	0.365	Q5SX07_MOUSE Dynein, axonemal, heavy chain 9 OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
13	Q9U3Y5	4.18e-91	330	4559	0.133	0.041	Q9U3Y5_DROME Dynein heavy chain OS=Drosophila melanogaster OX=7227 GN=kl-5 PE=2 SV=1
14	Q5LJN5	4.57e-91	330	4559	0.133	0.041	Q5LJN5_DROME Male fertility factor kl5 OS=Drosophila melanogaster OX=7227 GN=kl-5 PE=3 SV=4
15	Q9MBF8	4.84e-87	317	4513	0.223	0.069	DYH1B_CHLRE Dynein-1-beta heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC10 PE=1 SV=1
16	Q39575	1.46e-68	258	4485	0.200	0.062	DYHG_CHLRE Dynein gamma chain, flagellar outer arm OS=Chlamydomonas reinhardtii OX=3055 GN=ODA2 PE=1 SV=1
17	Q57WX6	1.25e-54	213	4639	0.181	0.055	Q57WX6_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27F10.490 PE=4 SV=1
18	Q9SMH3	1.78e-52	206	4625	0.201	0.061	DYH1A_CHLRE Dynein-1-alpha heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC1 PE=1 SV=1
19	Q5LJP0	3.08e-52	205	4459	0.199	0.062	Q5LJP0_DROME Male fertility factor kl2 OS=Drosophila melanogaster OX=7227 GN=kl-2 PE=3 SV=5
20	D3YYQ8	6.87e-47	188	4591	0.183	0.056	D3YYQ8_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08651 DASH_Duo1	98	14.2	DASH complex subunit Duo1
2	PF08385 DHC_N1	5.4e-157	535.5	Dynein heavy chain, N-terminal region 1
3	PF08393 DHC_N2	8.7e-25	99.3	Dynein heavy chain, N-terminal region 2
4	PF07568 HisKA_2	19	16.7	Histidine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000374490

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000333363	0.924	Dynein heavy chain 8, axonemal
2	9606.ENSP00000458355	0.912	Dynein heavy chain 2, axonemal
3	9606.ENSP00000310829	0.908	Cilia- and flagella-associated protein 70
4	9606.ENSP00000400252	0.887	Dynein intermediate chain 2, axonemal
5	9606.ENSP00000354791	0.880	Dynactin subunit 1
6	9606.ENSP00000408910	0.861	Dynactin subunit 2
7	9606.ENSP00000452037	0.826	Dynein light chain 1, axonemal
8	9606.ENSP00000254286	0.820	Actin related protein 10 homolog
9	9606.ENSP00000289228	0.820	Beta-centractin
10	9606.ENSP00000358921	0.820	Alpha-centractin
11	9606.ENSP00000480538	0.813	Dynein intermediate chain 1, axonemal
12	9606.ENSP00000318429	0.807	Coiled-coil domain-containing protein 114
13	9606.ENSP00000414906	0.807	Dynactin subunit 4
14	9606.ENSP00000259632	0.803	Dynactin subunit 3
15	9606.ENSP00000334002	0.802	Huntingtin-associated protein 1
16	9606.ENSP00000300087	0.801	Dynactin subunit 5
17	9606.ENSP00000221114	0.800	Dynactin subunit 6
18	9606.ENSP00000265104	0.785	Dynein heavy chain 5, axonemal
19	9606.ENSP00000401514	0.783	Dynein heavy chain 1, axonemal
20	9606.ENSP00000294664	0.675	WD repeat-containing protein 63

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003774	0.576	cytoskeletal motor activity
GO:0003777	0.526	microtubule motor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007017	0.978	microtubule-based process
GO:0001578	0.916	microtubule bundle formation
GO:0060271	0.902	cilium assembly
GO:0035082	0.879	axoneme assembly
GO:0070286	0.841	axonemal dynein complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005930	1.000	axoneme
GO:0031514	0.998	motile cilium
GO:0005875	0.998	microtubule associated complex
GO:0097729	0.994	9+2 motile cilium
GO:0030286	0.972	dynein complex
GO:0005858	0.930	axonemal dynein complex
GO:0036157	0.370	outer dynein arm
GO:0120135	0.363	distal portion of axoneme
GO:0036126	0.345	sperm flagellum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]