StarFunc result for job id Q9UFW8

User Input

>input (167 residues)
MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISD
HLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEK
ADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQDC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UFW8	1.000	1.000	5.360E-30	167	1.000	1.000	Q9UFW8.pdb.gz	CGBP1_HUMAN CGG triplet repeat-binding protein 1 OS=Homo sapiens OX=9606 GN=CGGBP1 PE=1 SV=2
2	AFDB:B2RPU8	0.232	0.071	2.946E-2	756	0.162	0.036	B2RPU8.pdb.gz	B2RPU8_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 2-like OS=Mus musculus OX=10090 GN=Zbed5 PE=1 SV=1
3	AFDB:Q586K6	0.306	0.242	8.514E-2	229	0.096	0.070	Q586K6.pdb.gz	Q586K6_TRYB2 SF3A2 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=25N14.130 PE=4 SV=1
4	AFDB:Q8VD12	0.231	0.106	8.514E-2	386	0.108	0.047	Q8VD12.pdb.gz	Z385A_MOUSE Zinc finger protein 385A OS=Mus musculus OX=10090 GN=Znf385a PE=1 SV=2
5	AFDB:A0A178VXZ1	0.269	0.169	1.027E-1	277	0.090	0.054	A0A178VXZ1.pdb.gz	A0A178VXZ1_ARATH Matrin-type domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At2g32600 PE=1 SV=1
6	AFDB:Q9P7L8	0.266	0.210	1.403E-1	217	0.090	0.069	Q9P7L8.pdb.gz	SAP62_SCHPO Pre-mRNA-splicing factor sap62 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sap62 PE=1 SV=1
7	PDB:6n7pB	0.235	0.205	1.440E-1	195	0.138	0.118	6n7pB.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
8	AFDB:Q19335	0.265	0.208	1.493E-1	222	0.078	0.059	Q19335.pdb.gz	Q19335_CAEEL Matrin-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=repo-1 PE=1 SV=2
9	AFDB:Q8VEH5	0.273	0.099	1.692E-1	606	0.168	0.046	Q8VEH5.pdb.gz	EPMIP_MOUSE EPM2A-interacting protein 1 OS=Mus musculus OX=10090 GN=Epm2aip1 PE=1 SV=1
10	AFDB:Q9VU15	0.267	0.176	1.801E-1	264	0.072	0.045	Q9VU15.pdb.gz	Q9VU15_DROME LD47455p OS=Drosophila melanogaster OX=7227 GN=Sf3a2 PE=1 SV=1
11	PDB:7abiF	0.245	0.247	1.849E-1	165	0.054	0.055	7abiF.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
12	PDB:5z56v	0.256	0.256	2.230E-1	167	0.066	0.066	5z56v.pdb.gz	Structure of the human activated spliceosome in three conformational states.
13	AFDB:E7FE25	0.230	0.096	2.312E-1	439	0.102	0.039	E7FE25.pdb.gz
14	PDB:5gm6I	0.231	0.367	2.690E-1	102	0.096	0.157	5gm6I.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
15	PDB:6qx91C	0.235	0.685	4.718E-1	50	0.048	0.160	6qx91C.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
16	PDB:5nrlU	0.265	0.228	6.056E-1	196	0.072	0.061	5nrlU.pdb.gz	Structure of a pre-catalytic spliceosome.
17	PDB:6g90U	0.268	0.231	6.056E-1	196	0.072	0.061	6g90U.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
18	PDB:5zwmv	0.227	0.218	7.304E-1	174	0.072	0.069	5zwmv.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
19	PDB:7v3vI	0.162	0.090	9.980E-1	328	0.072	0.037	7v3vI.pdb.gz	Structural Insight into the MCM double hexamer activation by Dbf4-Cdc7 kinase.
20	PDB:6ff47	0.244	0.383	1.204	93	0.054	0.097	6ff47.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UFW8	7.94e-125	349	167	1.000	1.000	CGBP1_HUMAN CGG triplet repeat-binding protein 1 OS=Homo sapiens OX=9606 GN=CGGBP1 PE=1 SV=2
2	C9JUJ0	1.79e-74	220	106	0.635	1.000	C9JUJ0_HUMAN CGG triplet repeat binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=CGGBP1 PE=1 SV=1
3	Q8TER0	0.24	33.9	1413	0.102	0.012	SNED1_HUMAN Sushi, nidogen and EGF-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNED1 PE=1 SV=2
4	Q9DDV9	0.41	33.1	1684	0.114	0.011	Q9DDV9_ONCMY Complement component C3-4 (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
5	O88291	0.91	32.0	580	0.156	0.045	ZN326_MOUSE DBIRD complex subunit ZNF326 OS=Mus musculus OX=10090 GN=Znf326 PE=1 SV=1
6	Q7JM44	0.92	32.3	2242	0.108	0.008	SMA9_CAEEL Transcription factor sma-9 OS=Caenorhabditis elegans OX=6239 GN=sma-9 PE=1 SV=2
7	Q5BKZ1	2.3	30.8	582	0.132	0.038	ZN326_HUMAN DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326 PE=1 SV=2
8	Q8CCJ3	2.8	30.8	793	0.114	0.024	UFL1_MOUSE E3 UFM1-protein ligase 1 OS=Mus musculus OX=10090 GN=Ufl1 PE=1 SV=2
9	A0A0A0MRN4	3.7	30.0	493	0.132	0.045	A0A0A0MRN4_HUMAN Zinc finger protein 326 OS=Homo sapiens OX=9606 GN=ZNF326 PE=1 SV=1
10	P52377	5.7	29.6	859	0.078	0.015	OBP_BHV1C Replication origin-binding protein OS=Bovine herpesvirus 1.1 (strain Cooper) OX=10323 GN=UL9 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04988 AKAP95	4.2	19.1	A-kinase anchoring protein 95 (AKAP95)
2	PF10376 Mei5	1.8	19.9	Double-strand recombination repair protein
3	PF01927 Mut7-C	1e+02	14.4	Mut7-C RNAse domain
4	PF13611 Peptidase_S76	2.4e+02	13.5	Serine peptidase of plant viral polyprotein, P1
5	PF18658 zf-C2H2_12	5e+02	11.8	Spin-doc zinc-finger
6	PF12756 zf-C2H2_2	7.2	18.3	C2H2 type zinc-finger (2 copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008830455.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008832771.1	0.583	Putative ataxin-7-like protein 3B
2	1026970.XP_008831433.1	0.564	Spindlin-1 isoform X1
3	1026970.XP_008843093.1	0.539	Nei like DNA glycosylase 1
4	1026970.XP_008853172.1	0.537	methyl-CpG-binding domain protein 4
5	1026970.XP_008835504.1	0.522	Fragile X mental retardation protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0140297	1.000	DNA-binding transcription factor binding
GO:0003690	1.000	double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0045934	0.987	negative regulation of nucleobase-containing compound metabolic process
GO:0010605	0.983	negative regulation of macromolecule metabolic process
GO:0010556	0.972	regulation of macromolecule biosynthetic process
GO:0031326	0.972	regulation of cellular biosynthetic process
GO:0051252	0.972	regulation of RNA metabolic process
GO:0010468	0.967	regulation of gene expression
GO:0006355	0.962	regulation of DNA-templated transcription
GO:1903507	0.959	negative regulation of nucleic acid-templated transcription
GO:0045892	0.954	negative regulation of DNA-templated transcription
GO:0071840	0.940	cellular component organization or biogenesis
GO:0016043	0.932	cellular component organization
GO:0006357	0.892	regulation of transcription by RNA polymerase II
GO:0006325	0.850	chromatin organization
GO:0040029	0.712	epigenetic regulation of gene expression
GO:0000122	0.438	negative regulation of transcription by RNA polymerase II
GO:0050896	0.308	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.780	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]