StarFunc result for job id Q9UG01

User Input

>input (1749 residues)
MHLKHLRTLLSPQDGAAKVTCMAWSQNNAKFAVCTVDRVVLLYDEHGERRDKFSTKPADM
KYGRKSYMVKGMAFSPDSTKIAIGQTDNIIYVYKIGEDWGDKKVICNKFIQTSAVTCLQW
PAEYIIVFGLAEGKVRLANTKTNKSSTIYGTESYVVSLTTNCSGKGILSGHADGTIVRYF
FDDEGSGESQGKLVNHPCPPYALAWATNSIVAAGCDRKIVAYGKEGHMLQTFDYSRDPQE
REFTTAVSSPGGQSVVLGSYDRLRVFNWIPRRSIWEEAKPKEITNLYTITALAWKRDGSR
LCVGTLCGGVEQFDCCLRRSIYKNKFELTYVGPSQVIVKNLSSGTRVVLKSHYGYEVEEV
KILGKERYLVAHTSETLLLGDLNTNRLSEIAWQGSGGNEKYFFENENVCMIFNAGELTLV
EYGNNDTLGSVRTEFMNPHLISVRINERCQRGTEDNKKLAYLIDIKTIAIVDLIGGYNIG
TVSHESRVDWLELNETGHKLLFRDRKLRLHLYDIESCSKTMILNFCSYMQWVPGSDVLVA
QNRNSLCVWYNIEAPERVTMFTIRGDVIGLERGGGKTEVMVMEGVTTVAYTLDEGLIEFG
TAIDDGNYIRATAFLETLEMTPETEAMWKTLSKLALEARQLHIAERCFSALGQVAKARFL
HETNEIADQVSREYGGEGTDFYQVRARLAMLEKNYKLAEMIFLEQNAVEEAMGMYQELHR
WDECIAVAEAKGHPALEKLRRSYYQWLMDTQQEERAGELQESQGDGLAAISLYLKAGLPA
KAARLVLTREELLANTELVEHITAALIKGELYERAGDLFEKIHNPQKALECYRKGNAFMK
AVELARLAFPVEVVKLEEAWGDHLVQQKQLDAAINHYIEARCSIKAIEAALGARQWKKAI
YILDLQDRNTASKYYPLVAQHYASLQEYEIAEELYTKGDRTKDAIDMYTQAGRWEQAHKL
AMKCMRPEDVSVLYITQAQEMEKQGKYREAERLYVTVQEPDLAITMYKKHKLYDDMIRLV
GKHHPDLLSDTHLHLGKELEAEGRLQEAEYHYLEAQEWKATVNMYRASGLWEEAYRVART
QGGANAHKHVAYLWAKSLGGEAAVRLLNKLGLLEAAVDHAADNCSFEFAFELSRLALKHK
TPEVHLKYAMFLEDEGKFEEAEAEFIRAGKPKEAVLMFVHNQDWEAAQRVAEAHDPDSVA
EVLVGQARGALEEKDFQKAEGLLLRAQRPGLALNYYKEAGLWSDALRICKDYVPSQLEAL
QEEYEREATKKGARGVEGFVEQARHWEQAGEYSRAVDCYLKVRDSGNSGLAEKCWMKAAE
LSIKFLPPQRNMEVVLAVGPQLIGIGKHSAAAELYLNLDLVKEAIDAFIEGEEWNKAKRV
AKELDPRYEDYVDQHYKEFLKNQGKVDSLVGVDVIAALDLYVEQGQWDKCIETATKQNYK
ILHKYVALYATHLIREGSSAQALALYVQHGAPANPQNFNIYKRIFTDMVSSPGTNCAEAY
HSWADLRDVLFNLCENLVKSSEANSPAHEEFKTMLLIAHYYATRSAAQSVKQLETVAARL
SVSLLRHTQLLPVDKAFYEAGIAAKAVGWDNMAFIFLNRFLDLTDAIEEGTLDGLDHSDF
QDTDIPFEVPLPAKQHVPEAEREEVRDWVLTVSMDQRLEQVLPRDERGAYEASLVAASTG
VRALPCLITGYPILRNKIEFKRPGKAANKDNWNKFLMAIKTSHSPVCQDVLKFISQWCGG
LPSTSFSFQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q22830	0.432	0.435	0.000	1737	0.423	0.425	Q22830.pdb.gz	OSM1_CAEEL Intraflagellar transport protein osm-1 OS=Caenorhabditis elegans OX=6239 GN=osm-1 PE=1 SV=4
2	AFDB:Q38CC3	0.395	0.396	0.000	1747	0.403	0.403	Q38CC3.pdb.gz	Q38CC3_TRYB2 Intraflagellar transport protein 172 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6920 PE=4 SV=1
3	AFDB:Q5DM57	0.384	0.383	0.000	1755	0.442	0.440	Q5DM57.pdb.gz	IF172_CHLRE Intraflagellar transport protein 172 OS=Chlamydomonas reinhardtii OX=3055 GN=IFT172 PE=1 SV=1
4	AFDB:Q5RHH4	0.866	0.868	0.000	1745	0.751	0.752	Q5RHH4.pdb.gz	IF172_DANRE Intraflagellar transport protein 172 homolog OS=Danio rerio OX=7955 GN=ift172 PE=2 SV=1
5	AFDB:Q6VH22	0.797	0.797	0.000	1749	0.958	0.958	Q6VH22.pdb.gz	IF172_MOUSE Intraflagellar transport protein 172 homolog OS=Mus musculus OX=10090 GN=Ift172 PE=1 SV=1
6	AFDB:Q9W040	0.522	0.521	0.000	1754	0.470	0.469	Q9W040.pdb.gz	OSM1_DROME Intraflagellar transport protein 172 homolog OS=Drosophila melanogaster OX=7227 GN=Oseg2 PE=3 SV=3
7	AFDB:Q3UGF1	0.146	0.184	1.541E-32	1341	0.136	0.177	Q3UGF1.pdb.gz	WDR19_MOUSE WD repeat-containing protein 19 OS=Mus musculus OX=10090 GN=Wdr19 PE=1 SV=1
8	AFDB:G5EFW7	0.157	0.226	3.049E-32	1192	0.088	0.129	G5EFW7.pdb.gz	IF122_CAEEL Intraflagellar transport protein 122 homolog OS=Caenorhabditis elegans OX=6239 GN=daf-10 PE=1 SV=1
9	AFDB:Q8NEZ3	0.151	0.191	3.049E-32	1342	0.130	0.170	Q8NEZ3.pdb.gz	WDR19_HUMAN WD repeat-containing protein 19 OS=Homo sapiens OX=9606 GN=WDR19 PE=1 SV=2
10	AFDB:Q8T9D3	0.155	0.212	3.520E-32	1169	0.098	0.146	Q8T9D3.pdb.gz	Q8T9D3_DROME SD05642p OS=Drosophila melanogaster OX=7227 GN=Oseg1 PE=2 SV=1
11	PDB:5nzrC	0.162	0.316	5.240E-18	843	0.065	0.135	5nzrC.pdb.gz
12	PDB:6qk7A	0.160	0.232	3.514E-17	1161	0.078	0.118	6qk7A.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
13	PDB:7mq8LR	0.143	0.307	7.708E-16	773	0.054	0.123	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7mqaLO	0.124	0.256	1.698E-15	819	0.063	0.136	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:5a1vK	0.173	0.254	4.477E-15	1126	0.079	0.123	5a1vK.pdb.gz
16	PDB:7mq8LO	0.127	0.255	8.244E-15	848	0.067	0.138	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:1xi4A	0.088	0.093	1.518E-14	1630	0.110	0.118	1xi4A.pdb.gz
18	PDB:7mq8LN	0.144	0.360	1.690E-14	671	0.050	0.130	7mq8LN.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:1nr0A	0.146	0.396	2.696E-14	610	0.042	0.121	1nr0A.pdb.gz
20	PDB:7mqaLQ	0.135	0.269	2.696E-14	830	0.059	0.125	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q22830	0.0	1456	1737	0.426	0.429	OSM1_CAEEL Intraflagellar transport protein osm-1 OS=Caenorhabditis elegans OX=6239 GN=osm-1 PE=1 SV=4
2	Q38CC3	0.0	1329	1747	0.419	0.419	Q38CC3_TRYB2 Intraflagellar transport protein 172 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6920 PE=4 SV=1
3	Q5DM57	0.0	1506	1755	0.445	0.443	IF172_CHLRE Intraflagellar transport protein 172 OS=Chlamydomonas reinhardtii OX=3055 GN=IFT172 PE=1 SV=1
4	Q5RHH4	0.0	2841	1745	0.752	0.754	IF172_DANRE Intraflagellar transport protein 172 homolog OS=Danio rerio OX=7955 GN=ift172 PE=2 SV=1
5	Q6VH22	0.0	3511	1749	0.959	0.959	IF172_MOUSE Intraflagellar transport protein 172 homolog OS=Mus musculus OX=10090 GN=Ift172 PE=1 SV=1
6	Q9JKU3	0.0	3505	1749	0.958	0.958	IF172_RAT Intraflagellar transport protein 172 homolog OS=Rattus norvegicus OX=10116 GN=Ift172 PE=1 SV=1
7	Q9UG01	0.0	3638	1749	1.000	1.000	IF172_HUMAN Intraflagellar transport protein 172 homolog OS=Homo sapiens OX=9606 GN=IFT172 PE=1 SV=2
8	Q9W040	0.0	1659	1754	0.475	0.474	OSM1_DROME Intraflagellar transport protein 172 homolog OS=Drosophila melanogaster OX=7227 GN=Oseg2 PE=3 SV=3
9	Q8K057	1.06e-11	72.4	777	0.070	0.157	IFT80_MOUSE Intraflagellar transport protein 80 homolog OS=Mus musculus OX=10090 GN=Ift80 PE=1 SV=1
10	Q5PRA9	2.43e-10	68.2	777	0.082	0.185	Q5PRA9_DANRE Intraflagellar transport 80 homolog (Chlamydomonas) OS=Danio rerio OX=7955 GN=wu:fj11a06 PE=2 SV=1
11	Q388A9	3.48e-10	67.4	782	0.067	0.151	Q388A9_TRYB2 Intraflagellar transport protein 80 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1560 PE=4 SV=1
12	Q68K27	8.09e-08	60.1	1384	0.059	0.074	Q68K27_CHLRE Intraflagellar transport particle protein 140 OS=Chlamydomonas reinhardtii OX=3055 GN=IFT140 PE=1 SV=1
13	Q9P2H3	8.26e-08	59.7	777	0.058	0.130	IFT80_HUMAN Intraflagellar transport protein 80 homolog OS=Homo sapiens OX=9606 GN=IFT80 PE=1 SV=3
14	Q7KTZ4	4.32e-06	54.3	1503	0.059	0.069	Q7KTZ4_DROME Reduced mechanoreceptor potential A, isoform B OS=Drosophila melanogaster OX=7227 GN=rempA PE=4 SV=1
15	Q9VPR0	5.44e-06	53.9	1458	0.059	0.071	Q9VPR0_DROME LP14662p OS=Drosophila melanogaster OX=7227 GN=rempA PE=2 SV=2
16	Q38B65	6.05e-05	50.4	1242	0.033	0.046	Q38B65_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1660 PE=4 SV=1
17	Q6NWV3	1.24e-04	49.7	1182	0.032	0.047	IF122_MOUSE Intraflagellar transport protein 122 homolog OS=Mus musculus OX=10090 GN=Ift122 PE=1 SV=1
18	Q9HBG6	1.37e-04	49.3	1241	0.031	0.044	IF122_HUMAN Intraflagellar transport protein 122 homolog OS=Homo sapiens OX=9606 GN=IFT122 PE=1 SV=2
19	P0CY34	3.03e-04	47.8	512	0.033	0.111	TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TUP1 PE=2 SV=1
20	Q6NYH1	3.50e-04	48.1	1187	0.031	0.045	IF122_DANRE Intraflagellar transport protein 122 homolog OS=Danio rerio OX=7955 GN=ift122 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	5e-05	34.8	Anaphase-promoting complex subunit 4 WD40 domain
2	PF00637 Clathrin	8e-10	50.2	Region in Clathrin and VPS
3	PF04053 Coatomer_WDAD	5.4	17.6	Coatomer WD associated region
4	PF06920 DHR-2_Lobe_A	9.2e+02	11.5	DHR-2, Lobe A
5	PF10602 RPN7	25	16.0	26S proteasome subunit RPN7
6	PF00515 TPR_1	55	15.0	Tetratricopeptide repeat
7	PF13424 TPR_12	53	15.5	Tetratricopeptide repeat
8	PF07719 TPR_2	17	16.8	Tetratricopeptide repeat
9	PF00400 WD40	0.00028	32.8	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260570

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264538	0.997	Intraflagellar transport protein 57 homolog
2	9606.ENSP00000242591	0.995	Intraflagellar transport protein 81 homolog
3	9606.ENSP00000323580	0.995	Intraflagellar transport protein 88 homolog
4	9606.ENSP00000362424	0.993	TRAF3-interacting protein 1
5	9606.ENSP00000362121	0.989	Intraflagellar transport protein 52 homolog
6	9606.ENSP00000406012	0.983	Intraflagellar transport protein 140 homolog
7	9606.ENSP00000358918	0.981	Suppressor of fused homolog
8	9606.ENSP00000464443	0.980	Intraflagellar transport protein 20 homolog
9	9606.ENSP00000264020	0.979	Intraflagellar transport proteins
10	9606.ENSP00000404122	0.979	Intraflagellar transport protein 74 homolog
11	9606.ENSP00000460850	0.978	Clusterin-associated protein 1
12	9606.ENSP00000419279	0.971	Intraflagellar transport protein 56
13	9606.ENSP00000382717	0.970	WD repeat-containing protein 19
14	9606.ENSP00000320359	0.969	Intraflagellar transport protein 22 homolog
15	9606.ENSP00000393541	0.967	Intraflagellar transport protein 27 homolog
16	9606.ENSP00000296266	0.966	Intraflagellar transport protein 122 homolog
17	9606.ENSP00000381167	0.966	Cytoplasmic dynein 2 heavy chain 1
18	9606.ENSP00000243344	0.958	Tetratricopeptide repeat protein 21B
19	9606.ENSP00000228682	0.954	Zinc finger protein GLI1
20	9606.ENSP00000379258	0.954	Transcriptional activator GLI3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0070925	0.971	organelle assembly
GO:0044782	0.964	cilium organization
GO:0120031	0.955	plasma membrane bounded cell projection assembly
GO:0060271	0.954	cilium assembly
GO:0065007	0.892	biological regulation
GO:0050794	0.875	regulation of cellular process
GO:0051179	0.477	localization
GO:0051641	0.399	cellular localization
GO:0032501	0.371	multicellular organismal process
GO:0048523	0.326	negative regulation of cellular process
GO:0048856	0.305	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005929	0.998	cilium
GO:0030990	0.996	intraciliary transport particle
GO:0005622	0.979	intracellular anatomical structure
GO:0031982	0.970	vesicle
GO:0005634	0.967	nucleus
GO:0030992	0.958	intraciliary transport particle B
GO:0097542	0.886	ciliary tip
GO:0043232	0.850	intracellular non-membrane-bounded organelle
GO:0005737	0.828	cytoplasm
GO:0005829	0.614	cytosol
GO:0016020	0.532	membrane
GO:0005856	0.522	cytoskeleton
GO:0005615	0.445	extracellular space
GO:0070062	0.414	extracellular exosome
GO:0005813	0.403	centrosome
GO:0031514	0.376	motile cilium
GO:0070013	0.334	intracellular organelle lumen
GO:0031981	0.307	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]