StarFunc result for job id Q9UG56

User Input

>input (409 residues)
MATSVGHRCLGLLHGVAPWRSSLHPCEITALSQSLQPLRKLPFRAFRTDARKIHTAPART
MFLLRPLPILLVTGGGYAGYRQYEKYRERELEKLGLEIPPKLAGHWEVALYKSVPTRLLS
RAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPV
CGLHSVISPSDGRILNFGQVKNCEVEQVKGVTYSLESFLGPRMCTEDLPFPPAASCDSFK
NQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKELFC
HNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRHSKGSYNDFSFVTHTNR
EGVPMRKGEHLGEFNLGSTIVLIFEAPKDFNFQLKTGQKIRFGEALGSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UG56	1.000	1.000	7.838E-84	409	1.000	1.000	Q9UG56.pdb.gz	PISD_HUMAN Phosphatidylserine decarboxylase proenzyme, mitochondrial OS=Homo sapiens OX=9606 GN=PISD PE=1 SV=4
2	AFDB:D3ZAW2	0.831	0.837	2.328E-69	406	0.846	0.852	D3ZAW2.pdb.gz	PISD_RAT Phosphatidylserine decarboxylase proenzyme, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pisd PE=1 SV=3
3	AFDB:O14333	0.678	0.636	1.256E-38	437	0.391	0.366	O14333.pdb.gz	PSD1_SCHPO Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psd1 PE=3 SV=4
4	AFDB:P39006	0.680	0.559	1.896E-38	500	0.389	0.318	P39006.pdb.gz	PSD1_YEAST Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSD1 PE=1 SV=1
5	AFDB:Q5ABC5	0.648	0.452	5.791E-38	590	0.374	0.259	Q5ABC5.pdb.gz	PSD1_CANAL Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PSD1 PE=3 SV=1
6	AFDB:Q84V22	0.711	0.645	6.078E-37	453	0.325	0.294	Q84V22.pdb.gz	PSD1_ARATH Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PSD1 PE=2 SV=1
7	AFDB:Q9UTB5	0.655	0.523	7.688E-37	516	0.399	0.316	Q9UTB5.pdb.gz	PSD2_SCHPO Phosphatidylserine decarboxylase proenzyme 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psd2 PE=3 SV=1
8	AFDB:Q8I2N0	0.653	0.754	2.206E-30	353	0.252	0.292	Q8I2N0.pdb.gz	Q8I2N0_PLAF7 Phosphatidylserine decarboxylase proenzyme OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0927900 PE=3 SV=1
9	AFDB:Q38DZ5	0.661	0.755	3.706E-29	356	0.240	0.275	Q38DZ5.pdb.gz	Q38DZ5_TRYB2 phosphatidylserine decarboxylase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1610 PE=4 SV=1
10	AFDB:P0A8K1	0.617	0.775	1.901E-27	322	0.222	0.283	P0A8K1.pdb.gz	PSD_ECOLI Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain K12) OX=83333 GN=psd PE=1 SV=1
11	PDB:7reiA	0.086	0.123	4.399E-2	243	0.049	0.082	7reiA.pdb.gz	Crystal structure of human cysteamine dioxygenase provides a structural rationale for its function as an oxygen sensor.
12	PDB:7lvzD	0.085	0.121	1.195E-1	246	0.029	0.049	7lvzD.pdb.gz	The Crystal Structure of Cysteamine Dioxygenase Reveals the Origin of the Large Substrate Scope of This Vital Mammalian Enzyme.
13	PDB:1tlzA	0.070	0.102	1.425E-1	251	0.039	0.064	1tlzA.pdb.gz	Crystal structure of the bacterial nucleoside transporter Tsx.
14	PDB:1xe8B	0.093	0.156	1.912E-1	193	0.037	0.078	1xe8B.pdb.gz	Crystal structure of the YML079w protein from Saccharomyces cerevisiae reveals a new sequence family of the jelly-roll fold
15	PDB:1zvfA	0.072	0.131	1.912E-1	176	0.037	0.085	1zvfA.pdb.gz
16	PDB:2r55A	0.090	0.142	2.565E-1	208	0.066	0.130	2r55A.pdb.gz
17	PDB:2x8kC	0.095	0.133	2.565E-1	243	0.078	0.132	2x8kC.pdb.gz
18	PDB:4qi7A	0.074	0.045	2.720E-1	805	0.029	0.015	4qi7A.pdb.gz	Structural basis for cellobiose dehydrogenase action during oxidative cellulose degradation.
19	PDB:6fxrA	0.138	0.088	2.885E-1	700	0.046	0.027	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
20	PDB:6o6wA	0.061	0.106	3.870E-1	147	0.039	0.109	6o6wA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZAW2	0.0	711	406	0.846	0.852	PISD_RAT Phosphatidylserine decarboxylase proenzyme, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pisd PE=1 SV=3
2	Q8BSF4	0.0	707	406	0.851	0.857	PISD_MOUSE Phosphatidylserine decarboxylase proenzyme, mitochondrial OS=Mus musculus OX=10090 GN=Pisd PE=2 SV=1
3	Q9UG56	0.0	850	409	1.000	1.000	PISD_HUMAN Phosphatidylserine decarboxylase proenzyme, mitochondrial OS=Homo sapiens OX=9606 GN=PISD PE=1 SV=4
4	O14333	1.08e-86	272	437	0.377	0.352	PSD1_SCHPO Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psd1 PE=3 SV=4
5	Q5ABC5	5.37e-77	251	590	0.381	0.264	PSD1_CANAL Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PSD1 PE=3 SV=1
6	Q84V22	6.19e-65	216	453	0.337	0.305	PSD1_ARATH Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PSD1 PE=2 SV=1
7	Q8I2N0	8.21e-53	181	353	0.249	0.289	Q8I2N0_PLAF7 Phosphatidylserine decarboxylase proenzyme OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0927900 PE=3 SV=1
8	Q9UTB5	1.71e-46	169	516	0.213	0.169	PSD2_SCHPO Phosphatidylserine decarboxylase proenzyme 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psd2 PE=3 SV=1
9	A0A8H4BVL9	3.13e-46	167	500	0.215	0.176	A0A8H4BVL9_YEASX Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Saccharomyces cerevisiae OX=4932 GN=PSD1 PE=3 SV=1
10	P39006	3.13e-46	167	500	0.215	0.176	PSD1_YEAST Phosphatidylserine decarboxylase proenzyme 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSD1 PE=1 SV=1
11	P0A8K1	7.42e-33	127	322	0.230	0.292	PSD_ECOLI Phosphatidylserine decarboxylase proenzyme OS=Escherichia coli (strain K12) OX=83333 GN=psd PE=1 SV=1
12	Q38DZ5	7.65e-26	109	356	0.213	0.244	Q38DZ5_TRYB2 phosphatidylserine decarboxylase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1610 PE=4 SV=1
13	A4GNA8	9.64e-19	90.5	635	0.191	0.123	PSD3_ARATH Phosphatidylserine decarboxylase proenzyme 3 OS=Arabidopsis thaliana OX=3702 GN=PSD3 PE=1 SV=1
14	F4KAK5	2.62e-17	86.3	635	0.191	0.123	PSD2_ARATH Phosphatidylserine decarboxylase proenzyme 2 OS=Arabidopsis thaliana OX=3702 GN=PSD2 PE=2 SV=1
15	O14111	2.90e-17	86.3	967	0.183	0.078	PSD3_SCHPO Phosphatidylserine decarboxylase proenzyme 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psd3 PE=3 SV=2
16	Q5AK66	2.64e-16	83.6	1070	0.178	0.068	PSD2_CANAL Phosphatidylserine decarboxylase proenzyme 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PSD2 PE=3 SV=2
17	P53037	3.00e-10	64.7	1138	0.147	0.053	PSD2_YEAST Phosphatidylserine decarboxylase proenzyme 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSD2 PE=1 SV=1
18	Q6IRK9	2.1	33.1	472	0.130	0.112	CBPQ_RAT Carboxypeptidase Q OS=Rattus norvegicus OX=10116 GN=Cpq PE=1 SV=1
19	F4KEA3	4.1	32.3	578	0.051	0.036	F4KEA3_ARATH Agenet domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=DUF8 PE=4 SV=1
20	F4KEA4	4.8	32.0	421	0.051	0.050	DUF8_ARATH DUF724 domain-containing protein 8 OS=Arabidopsis thaliana OX=3702 GN=DUF8 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09213 M3	6.6e+02	10.4	M3
2	PF02666 PS_Dcarbxylase	7.2e-65	229.8	Phosphatidylserine decarboxylase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000007668

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000025820	0.993	Phosphatidylserine synthase 1
2	9593.ENSGGOP00000015049	0.989	Phosphatidylserine synthase 2
3	9593.ENSGGOP00000006453	0.959	Phospholipase D2
4	9593.ENSGGOP00000014031	0.959	Membrane bound O-acyltransferase domain containing 1
5	9593.ENSGGOP00000000006	0.942	Ethanolaminephosphotransferase 1 (CDP-ethanolamine-specific)
6	9593.ENSGGOP00000009354	0.942	Choline/ethanolamine phosphotransferase 1
7	9593.ENSGGOP00000002969	0.931	Phospholipase A1 member A
8	9593.ENSGGOP00000004211	0.923	Lysophosphatidylcholine acyltransferase 3
9	9593.ENSGGOP00000007501	0.921	Lysophosphatidylcholine acyltransferase 4
10	9593.ENSGGOP00000003541	0.906	Functions in the biosynthesis of the anionic phospholipids phosphatidylglycerol and cardiolipin
11	9593.ENSGGOP00000026134	0.906	Uncharacterized protein
12	9593.ENSGGOP00000013471	0.905	Cardiolipin synthase 1
13	9593.ENSGGOP00000009609	0.900	Phospholipase D family, member 4
14	9593.ENSGGOP00000010739	0.900	Phospholipase D family, member 3
15	9593.ENSGGOP00000021844	0.900	HRAS-like suppressor 2
16	9593.ENSGGOP00000025206	0.900	Phospholipase A2, group XVI
17	9593.ENSGGOP00000015231	0.849	CDP-diacylglycerol--inositol 3-phosphatidyltransferase
18	9593.ENSGGOP00000001454	0.822	Choline dehydrogenase
19	9593.ENSGGOP00000019132	0.782	Uncharacterized protein
20	9593.ENSGGOP00000012047	0.765	Phospholipase A2, group IVA (cytosolic, calcium-dependent)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004609	1.000	phosphatidylserine decarboxylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.992	primary metabolic process
GO:0008654	0.977	phospholipid biosynthetic process
GO:0046337	0.976	phosphatidylethanolamine metabolic process
GO:0044249	0.968	cellular biosynthetic process
GO:0046474	0.962	glycerophospholipid biosynthetic process
GO:0010876	0.951	lipid localization
GO:0051235	0.924	maintenance of location
GO:0034389	0.911	lipid droplet organization
GO:0022607	0.871	cellular component assembly
GO:0070925	0.750	organelle assembly
GO:0140694	0.742	non-membrane-bounded organelle assembly
GO:0019915	0.711	lipid storage
GO:0006807	0.697	nitrogen compound metabolic process
GO:1901564	0.662	organonitrogen compound metabolic process
GO:0065007	0.629	biological regulation
GO:0050789	0.613	regulation of biological process
GO:0050794	0.428	regulation of cellular process
GO:1901575	0.376	organic substance catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0005634	0.746	nucleus
GO:0016020	0.707	membrane
GO:0043232	0.665	intracellular non-membrane-bounded organelle
GO:0031981	0.421	nuclear lumen
GO:0031090	0.346	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:20828	1.000	a 1,2-diacyl-sn-glycero-3-phospho-L-serine + H(+) = a 1,2-diacyl-sn-glycero-3-phosphoethanolamine + CO2
EC:4.1.1.65	1.000	phosphatidylserine decarboxylase.

[back to server]