StarFunc result for job id Q9UGC7

User Input

>input (380 residues)
MRSRVLWGAARWLWPRRAVGPARRPLSSGSPPLEELFTRGGPLRTFLERQAGSEAHLKVR
RPELLAVIKLLNEKERELRETEHLLHDENEDLRKLAENEITLCQKEITQLKHQIILLLVP
SEETDENDLILEVTAGVGGQEAMLFTSEIFDMYQQYAAFKRWHFETLEYFPSELGGLRHA
SASIGGSEAYRHMKFEGGVHRVQRVPKTEKQGRVHTSTMTVAILPQPTEINLVINPKDLR
IDTKRASGAGGQHVNTTDSAVRIVHLPTGVVSECQQERSQLKNKELAMTKLRAKLYSMHL
EEEINKRQNARKIQIGSKGRSEKIRTYNFPQNRVTDHRINKTLHDLETFMQGDYLLDELV
QSLKEYADYESLVEIISQKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UGC7	1.000	1.000	4.843E-71	380	1.000	1.000	Q9UGC7.pdb.gz	RF1ML_HUMAN Peptide chain release factor 1-like, mitochondrial OS=Homo sapiens OX=9606 GN=MTRF1L PE=1 SV=1
2	AFDB:Q8BJU9	0.911	0.927	7.774E-58	373	0.774	0.788	Q8BJU9.pdb.gz	RF1ML_MOUSE Peptide chain release factor 1-like, mitochondrial OS=Mus musculus OX=10090 GN=Mtrf1l PE=2 SV=1
3	AFDB:Q8K126	0.840	0.722	1.217E-40	446	0.445	0.379	Q8K126.pdb.gz	RF1M_MOUSE Peptide chain release factor 1, mitochondrial OS=Mus musculus OX=10090 GN=Mtrf1 PE=2 SV=1
4	AFDB:O75570	0.843	0.723	1.288E-40	445	0.432	0.369	O75570.pdb.gz	RF1M_HUMAN Peptide chain release factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=MTRF1 PE=1 SV=2
5	PDB:7nqhBL	0.625	0.934	9.666E-40	250	0.655	0.996	7nqhBL.pdb.gz	Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
6	AFDB:O51214	0.704	0.745	2.268E-37	357	0.392	0.417	O51214.pdb.gz	RF1_BORBU Peptide chain release factor 1 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=prfA PE=3 SV=1
7	AFDB:Q8RX79	0.703	0.638	5.982E-37	422	0.376	0.339	Q8RX79.pdb.gz	APG3_ARATH Peptide chain release factor APG3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APG3 PE=2 SV=1
8	AFDB:P0A7I0	0.710	0.747	1.037E-35	360	0.363	0.383	P0A7I0.pdb.gz	RF1_ECOLI Peptide chain release factor RF1 OS=Escherichia coli (strain K12) OX=83333 GN=prfA PE=1 SV=1
9	AFDB:Q09691	0.783	0.753	3.637E-35	396	0.332	0.318	Q09691.pdb.gz	RF1M_SCHPO Putative peptide chain release factor 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2F7.17 PE=3 SV=1
10	AFDB:P30775	0.714	0.661	2.530E-34	413	0.374	0.344	P30775.pdb.gz	RF1M_YEAST Peptide chain release factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRF1 PE=1 SV=1
11	PDB:6gxnv	0.657	0.710	3.885E-29	348	0.366	0.399	6gxnv.pdb.gz	Visualization of translation termination intermediates trapped by the Apidaecin 137 peptide during RF3-mediated recycling of RF1.
12	AFDB:P07012	0.643	0.668	1.469E-27	365	0.263	0.274	P07012.pdb.gz	RF2_ECOLI Peptide chain release factor RF2 OS=Escherichia coli (strain K12) OX=83333 GN=prfB PE=1 SV=3
13	PDB:6c4iv	0.640	0.669	2.314E-26	362	0.250	0.262	6c4iv.pdb.gz	Conformation of methylated GGQ in the Peptidyl Transferase Center during Translation Termination.
14	PDB:2b3tB	0.434	0.545	7.510E-25	300	0.337	0.427	2b3tB.pdb.gz	Molecular basis for bacterial class I release factor methylation by PrmC
15	PDB:5u4jv	0.259	0.728	2.379E-8	132	0.084	0.242	5u4jv.pdb.gz	Structural basis of co-translational quality control by ArfA and RF2 bound to ribosome.
16	PDB:7a5hC	0.182	0.577	2.854E-3	114	0.074	0.246	7a5hC.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
17	PDB:2gqqC	0.103	0.180	1.875E-2	157	0.058	0.140	2gqqC.pdb.gz
18	PDB:7ohxo	0.159	0.421	3.134E-2	112	0.034	0.116	7ohxo.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
19	PDB:6jt0B	0.119	0.088	4.168E-2	576	0.071	0.047	6jt0B.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
20	PDB:7dvqI	0.154	0.395	6.579E-2	128	0.032	0.094	7dvqI.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BJU9	0.0	626	373	0.808	0.823	RF1ML_MOUSE Peptide chain release factor 1-like, mitochondrial OS=Mus musculus OX=10090 GN=Mtrf1l PE=2 SV=1
2	Q9UGC7	0.0	783	380	1.000	1.000	RF1ML_HUMAN Peptide chain release factor 1-like, mitochondrial OS=Homo sapiens OX=9606 GN=MTRF1L PE=1 SV=1
3	Q8K126	1.02e-109	330	446	0.447	0.381	RF1M_MOUSE Peptide chain release factor 1, mitochondrial OS=Mus musculus OX=10090 GN=Mtrf1 PE=2 SV=1
4	O75570	4.58e-108	326	445	0.418	0.357	RF1M_HUMAN Peptide chain release factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=MTRF1 PE=1 SV=2
5	O51214	1.88e-98	298	357	0.384	0.409	RF1_BORBU Peptide chain release factor 1 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=prfA PE=3 SV=1
6	P0A7I0	2.25e-83	260	360	0.363	0.383	RF1_ECOLI Peptide chain release factor RF1 OS=Escherichia coli (strain K12) OX=83333 GN=prfA PE=1 SV=1
7	Q8RX79	2.55e-81	256	422	0.353	0.318	APG3_ARATH Peptide chain release factor APG3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APG3 PE=2 SV=1
8	Q09691	4.37e-69	224	396	0.321	0.308	RF1M_SCHPO Putative peptide chain release factor 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2F7.17 PE=3 SV=1
9	P30775	6.45e-68	222	413	0.342	0.315	RF1M_YEAST Peptide chain release factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRF1 PE=1 SV=1
10	P07012	3.82e-50	174	365	0.274	0.285	RF2_ECOLI Peptide chain release factor RF2 OS=Escherichia coli (strain K12) OX=83333 GN=prfB PE=1 SV=3
11	Q57WY8	2.58e-44	161	459	0.245	0.203	Q57WY8_TRYB2 Peptide chain release factor 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27F10.190 PE=3 SV=1
12	Q9LVY0	3.23e-33	130	456	0.266	0.221	PRFB1_ARATH Peptide chain release factor PrfB1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PRFB1 PE=2 SV=1
13	P9WHG1	9.81e-32	125	371	0.211	0.216	RF2_MYCTU Peptide chain release factor 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=prfB PE=1 SV=1
14	Q9C875	3.29e-11	65.5	257	0.082	0.121	Q9C875_ARATH Class I peptide chain release factor OS=Arabidopsis thaliana OX=3702 GN=T16O9.18 PE=1 SV=1
15	Q9HTA0	1.02e-10	62.8	204	0.076	0.142	Q9HTA0_PSEAE Probable peptide chain release factor OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA5470 PE=3 SV=1
16	Q05863	3.90e-07	51.6	155	0.061	0.148	YL281_YEAST Uncharacterized peptide chain release factor-like protein YLR281C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YLR281C PE=1 SV=1
17	Q9H3J6	9.20e-05	44.7	166	0.053	0.120	MTRFR_HUMAN Mitochondrial translation release factor in rescue OS=Homo sapiens OX=9606 GN=MTRFR PE=1 SV=1
18	F4J264	0.004	41.6	406	0.126	0.118	PRFB3_ARATH Peptide chain release factor PrfB3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PRFB3 PE=1 SV=1
19	Q9Y811	0.004	40.0	162	0.045	0.105	YONI_SCHPO Uncharacterized peptide chain release factor-like protein C1105.18c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1105.18c PE=3 SV=2
20	Q38CG3	0.008	40.8	632	0.071	0.043	Q38CG3_TRYB2 Prokaryotic-type class I peptide chain release factors domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7440 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10661 EssA	59	14.9	WXG100 protein secretion system (Wss), protein EssA
2	PF03462 PCRF	5.6e-49	178.1	PCRF domain
3	PF00472 RF-1	6.7e-36	134.1	RF-1 domain
4	PF12879 SICA_C	2.8e+02	12.9	SICA C-terminal inner membrane domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356202

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301585	0.874	Peptidyl-tRNA hydrolase ICT1, mitochondrial
2	9606.ENSP00000296805	0.842	Ribosome-releasing factor 2, mitochondrial
3	9606.ENSP00000343867	0.820	Ribosome-recycling factor, mitochondrial
4	9606.ENSP00000245539	0.818	Mitochondrial ribosomal protein S7
5	9606.ENSP00000404843	0.812	HemK methyltransferase family member 1
6	9606.ENSP00000253233	0.793	Probable peptide chain release factor C12orf65, mitochondrial
7	9606.ENSP00000356272	0.792	Required for meiotic nuclear division protein 1 homolog
8	9606.ENSP00000263629	0.791	Translation initiation factor IF-2, mitochondrial
9	9606.ENSP00000341082	0.772	Mitochondrial ribosomal protein L20
10	9606.ENSP00000356263	0.762	Protein-glutamate O-methyltransferase
11	9606.ENSP00000370508	0.758	Translation initiation factor IF-3, mitochondrial
12	9606.ENSP00000367346	0.757	Arginine-hydroxylase NDUFAF5, mitochondrial
13	9606.ENSP00000362036	0.749	Mitochondrial ribosomal protein S16
14	9606.ENSP00000002125	0.738	Protein arginine methyltransferase NDUFAF7, mitochondrial
15	9606.ENSP00000350353	0.736	Electron transfer flavoprotein beta subunit lysine methyltransferase
16	9606.ENSP00000419038	0.730	Elongation factor G, mitochondrial
17	9606.ENSP00000258455	0.729	Mitochondrial ribosomal protein S9
18	9606.ENSP00000233627	0.728	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
19	9606.ENSP00000306548	0.720	Mitochondrial ribosomal protein L13
20	9606.ENSP00000288937	0.710	Mitochondrial ribosomal protein L17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003747	1.000	translation release factor activity
GO:0005515	0.997	protein binding
GO:0003723	0.749	RNA binding
GO:0044877	0.363	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.994	cellular metabolic process
GO:0044238	0.993	primary metabolic process
GO:0071704	0.989	organic substance metabolic process
GO:0006807	0.987	nitrogen compound metabolic process
GO:0043170	0.982	macromolecule metabolic process
GO:0009058	0.979	biosynthetic process
GO:0034641	0.976	cellular nitrogen compound metabolic process
GO:1901564	0.964	organonitrogen compound metabolic process
GO:0044249	0.946	cellular biosynthetic process
GO:0010467	0.939	gene expression
GO:0044260	0.929	cellular macromolecule metabolic process
GO:0019538	0.925	protein metabolic process
GO:1901576	0.923	organic substance biosynthetic process
GO:0044271	0.889	cellular nitrogen compound biosynthetic process
GO:0006412	0.884	translation
GO:0071840	0.702	cellular component organization or biogenesis
GO:0065007	0.630	biological regulation
GO:0016043	0.621	cellular component organization
GO:0050789	0.613	regulation of biological process
GO:0050794	0.531	regulation of cellular process
GO:0043933	0.420	protein-containing complex organization
GO:0006415	0.379	translational termination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0005759	0.884	mitochondrial matrix
GO:0043232	0.602	intracellular non-membrane-bounded organelle
GO:0032991	0.579	protein-containing complex
GO:0016020	0.525	membrane
GO:0005654	0.418	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]