StarFunc result for job id Q9UGH3

User Input

>input (650 residues)
MMGIGKNTTSKSMEAGSSTEGKYEDEAKHPAFFTLPVVINGGATSSGEQDNEDTELMAIY
TTENGIAEKSSLAETLDSTGSLDPQRSDMIYTIEDVPPWYLCIFLGLQHYLTCFSGTIAV
PFLLADAMCVGYDQWATSQLIGTIFFCVGITTLLQTTFGCRLPLFQASAFAFLAPARAIL
SLDKWKCNTTDVSVANGTAELLHTEHIWYPRIREIQGAIIMSSLIEVVIGLLGLPGALLK
YIGPLTITPTVALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIYKSK
KGWTAYKLQLFKMFPIILAILVSWLLCFIFTVTDVFPPDSTKYGFYARTDARQGVLLVAP
WFKVPYPFQWGLPTVSAAGVIGMLSAVVASIIESIGDYYACARLSCAPPPPIHAINRGIF
VEGLSCVLDGIFGTGNGSTSSSPNIGVLGITKVGSRRVIQCGAALMLALGMIGKFSALFA
SLPDPVLGALFCTLFGMITAVGLSNLQFIDLNSSRNLFVLGFSIFFGLVLPSYLRQNPLV
TGITGIDQVLNVLLTTAMFVGGCVAFILDNTIPGTPEERGIRKWKKGVGKGNKSLDGMES
YNLPFGMNIIKKYRCFSYLPISPTFVGYTWKGLRKSDNSRSSDEDSQATG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B9VMA9	0.849	0.839	1.911E-84	658	0.935	0.924	B9VMA9.pdb.gz	B9VMA9_CHICK Sodium vitamin C co-transporter 2 OS=Gallus gallus OX=9031 GN=SVCT2 PE=2 SV=1
2	AFDB:Q9Z2J0	0.832	0.893	6.760E-66	605	0.578	0.621	Q9Z2J0.pdb.gz	S23A1_MOUSE Solute carrier family 23 member 1 OS=Mus musculus OX=10090 GN=Slc23a1 PE=1 SV=2
3	AFDB:Q3E7D0	0.711	0.653	1.229E-36	709	0.285	0.261	Q3E7D0.pdb.gz	NAT12_ARATH Nucleobase-ascorbate transporter 12 OS=Arabidopsis thaliana OX=3702 GN=NAT12 PE=1 SV=3
4	AFDB:Q0WPE9	0.664	0.790	8.395E-34	538	0.288	0.348	Q0WPE9.pdb.gz	NAT7_ARATH Nucleobase-ascorbate transporter 7 OS=Arabidopsis thaliana OX=3702 GN=NAT7 PE=2 SV=2
5	AFDB:Q8RWE9	0.666	0.806	2.739E-33	528	0.289	0.356	Q8RWE9.pdb.gz	NAT5_ARATH Nucleobase-ascorbate transporter 5 OS=Arabidopsis thaliana OX=3702 GN=NAT5 PE=2 SV=1
6	AFDB:Q27GI3	0.658	0.789	3.722E-33	532	0.282	0.344	Q27GI3.pdb.gz	NAT6_ARATH Nucleobase-ascorbate transporter 6 OS=Arabidopsis thaliana OX=3702 GN=NAT6 PE=2 SV=2
7	AFDB:Q8VZQ5	0.659	0.782	7.839E-33	539	0.271	0.327	Q8VZQ5.pdb.gz	NAT8_ARATH Nucleobase-ascorbate transporter 8 OS=Arabidopsis thaliana OX=3702 GN=NAT8 PE=2 SV=1
8	AFDB:Q9SHZ3	0.657	0.805	7.839E-33	520	0.283	0.354	Q9SHZ3.pdb.gz	NAT1_ARATH Nucleobase-ascorbate transporter 1 OS=Arabidopsis thaliana OX=3702 GN=NAT1 PE=2 SV=1
9	AFDB:Q8GZD4	0.658	0.765	4.327E-32	551	0.257	0.303	Q8GZD4.pdb.gz	NAT3_ARATH Nucleobase-ascorbate transporter 3 OS=Arabidopsis thaliana OX=3702 GN=NAT3 PE=2 SV=2
10	AFDB:Q46821	0.584	0.775	1.636E-21	482	0.189	0.255	Q46821.pdb.gz	UACT_ECOLI Uric acid transporter UacT OS=Escherichia coli (strain K12) OX=83333 GN=uacT PE=1 SV=2
11	PDB:5i6cA	0.582	0.773	2.978E-16	480	0.137	0.185	5i6cA.pdb.gz	Structure of eukaryotic purine/H(+) symporter UapA suggests a role for homodimerization in transport activity.
12	PDB:3qe7A	0.476	0.725	1.029E-12	407	0.166	0.265	3qe7A.pdb.gz	Structure and mechanism of the uracil transporter UraA
13	PDB:7lguA	0.421	0.405	4.687E-6	680	0.128	0.122	7lguA.pdb.gz	Molecular mechanism of prestin electromotive signal amplification.
14	PDB:7tvzA	0.406	0.327	1.401E-5	850	0.120	0.092	7tvzA.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
15	PDB:8cs9g	0.375	0.304	2.079E-5	832	0.114	0.089	8cs9g.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
16	PDB:4yzfA	0.356	0.457	2.269E-5	475	0.109	0.149	4yzfA.pdb.gz	Crystal structure of the anion exchanger domain of human erythrocyte band 3.
17	PDB:7ch1A	0.390	0.395	1.559E-4	640	0.095	0.097	7ch1A.pdb.gz	Structural insights into the gating mechanism of human SLC26A9 mediated by its C-terminal sequence.
18	PDB:6caaA	0.402	0.511	2.573E-3	477	0.120	0.164	6caaA.pdb.gz
19	PDB:2witA	0.138	0.156	4.246E-2	531	0.112	0.137	2witA.pdb.gz
20	PDB:5j4nA	0.114	0.148	5.523E-2	437	0.111	0.165	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B9VMA9	0.0	1237	658	0.935	0.924	B9VMA9_CHICK Sodium vitamin C co-transporter 2 OS=Gallus gallus OX=9031 GN=SVCT2 PE=2 SV=1
2	Q9EPR4	0.0	1232	648	0.946	0.949	S23A2_MOUSE Solute carrier family 23 member 2 OS=Mus musculus OX=10090 GN=Slc23a2 PE=1 SV=2
3	Q9UGH3	0.0	1323	650	1.000	1.000	S23A2_HUMAN Solute carrier family 23 member 2 OS=Homo sapiens OX=9606 GN=SLC23A2 PE=1 SV=1
4	Q9UHI7	0.0	765	598	0.575	0.625	S23A1_HUMAN Solute carrier family 23 member 1 OS=Homo sapiens OX=9606 GN=SLC23A1 PE=1 SV=4
5	Q9WTW7	0.0	771	604	0.585	0.629	S23A1_RAT Solute carrier family 23 member 1 OS=Rattus norvegicus OX=10116 GN=Slc23a1 PE=2 SV=1
6	Q9WTW8	0.0	1227	647	0.946	0.951	S23A2_RAT Solute carrier family 23 member 2 OS=Rattus norvegicus OX=10116 GN=Slc23a2 PE=1 SV=2
7	Q9Z2J0	0.0	792	605	0.583	0.626	S23A1_MOUSE Solute carrier family 23 member 1 OS=Mus musculus OX=10090 GN=Slc23a1 PE=1 SV=2
8	Q9SHZ3	1.18e-98	313	520	0.289	0.362	NAT1_ARATH Nucleobase-ascorbate transporter 1 OS=Arabidopsis thaliana OX=3702 GN=NAT1 PE=2 SV=1
9	Q0WPE9	5.97e-95	304	538	0.280	0.338	NAT7_ARATH Nucleobase-ascorbate transporter 7 OS=Arabidopsis thaliana OX=3702 GN=NAT7 PE=2 SV=2
10	Q27GI3	2.58e-92	297	532	0.278	0.340	NAT6_ARATH Nucleobase-ascorbate transporter 6 OS=Arabidopsis thaliana OX=3702 GN=NAT6 PE=2 SV=2
11	Q8RWE9	4.49e-91	294	528	0.283	0.348	NAT5_ARATH Nucleobase-ascorbate transporter 5 OS=Arabidopsis thaliana OX=3702 GN=NAT5 PE=2 SV=1
12	Q8VZQ5	4.75e-91	294	539	0.274	0.330	NAT8_ARATH Nucleobase-ascorbate transporter 8 OS=Arabidopsis thaliana OX=3702 GN=NAT8 PE=2 SV=1
13	Q3E7D0	1.07e-79	269	709	0.288	0.264	NAT12_ARATH Nucleobase-ascorbate transporter 12 OS=Arabidopsis thaliana OX=3702 GN=NAT12 PE=1 SV=3
14	Q8GZD4	2.13e-78	261	551	0.258	0.305	NAT3_ARATH Nucleobase-ascorbate transporter 3 OS=Arabidopsis thaliana OX=3702 GN=NAT3 PE=2 SV=2
15	Q46821	2.93e-27	117	482	0.180	0.243	UACT_ECOLI Uric acid transporter UacT OS=Escherichia coli (strain K12) OX=83333 GN=uacT PE=1 SV=2
16	Q4WGR0	2.11e-14	79.0	583	0.182	0.202	Q4WGR0_ASPFU Purine permease, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_7G05910 PE=3 SV=1
17	P0AGM7	5.30e-12	70.5	429	0.091	0.138	URAA_ECOLI Uracil permease OS=Escherichia coli (strain K12) OX=83333 GN=uraA PE=1 SV=1
18	Q2USE7	1.28e-11	70.1	586	0.178	0.198	Q2USE7_ASPOR Purine permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090005000455 PE=3 SV=1
19	Q9HE12	1.87e-09	63.2	601	0.071	0.077	YI31_SCHPO Putative purine permease C1399.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1399.01c PE=3 SV=1
20	P0AGM9	2.46e-09	62.4	463	0.092	0.130	XANP_ECOLI Xanthine permease XanP OS=Escherichia coli (strain K12) OX=83333 GN=xanP PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00860 Xan_ur_permease	2.7e-86	301.4	Permease family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010377240.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010380864.1	0.725	Catalyzes the oxidation of uric acid to 5-hydroxyisourate, which is further processed to form (S)-allantoin.
2	61622.XP_010386414.1	0.622	Polyadenylate-binding protein-interacting protein 2
3	61622.XP_010386411.1	0.613	Matrin 3
4	61622.XP_010382399.1	0.567	Retinoic acid induced 14
5	61622.XP_010360775.1	0.553	Solute carrier family 45 member 3
6	61622.XP_010364195.1	0.551	Solute carrier family 33 member 1
7	61622.XP_010352486.1	0.543	Binds the poly(A) tail of mRNA.
8	61622.XP_010364525.1	0.541	MCF.2 cell line derived transforming sequence-like 2
9	61622.XP_010378380.1	0.541	Mannose receptor C type 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0090482	1.000	vitamin transmembrane transporter activity
GO:0046943	1.000	carboxylic acid transmembrane transporter activity
GO:0015145	1.000	monosaccharide transmembrane transporter activity
GO:0005402	1.000	carbohydrate:monoatomic cation symporter activity
GO:0005343	1.000	organic acid:sodium symporter activity
GO:0008520	0.979	L-ascorbate:sodium symporter activity
GO:0015229	0.428	L-ascorbic acid transmembrane transporter activity
GO:0005488	0.423	binding
GO:0005515	0.345	protein binding
GO:0015205	0.301	nucleobase transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0051180	0.996	vitamin transport
GO:0015749	0.994	monosaccharide transmembrane transport
GO:0035461	0.993	vitamin transmembrane transport
GO:1905039	0.993	carboxylic acid transmembrane transport
GO:0071704	0.356	organic substance metabolic process
GO:0044238	0.321	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	1.000	intracellular anatomical structure
GO:0098590	1.000	plasma membrane region
GO:0005737	0.977	cytoplasm
GO:0043226	0.833	organelle
GO:0043227	0.810	membrane-bounded organelle
GO:0045178	0.801	basal part of cell
GO:0043231	0.793	intracellular membrane-bounded organelle
GO:0009925	0.779	basal plasma membrane
GO:0070013	0.376	intracellular organelle lumen
GO:0045177	0.315	apical part of cell
GO:0016324	0.301	apical plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]