StarFunc result for job id Q9UGI0

User Input

>input (708 residues)
MSERGIKWACEYCTYENWPSAIKCTMCRAQRPSGTIITEDPFKSGSSDVGRDWDPSSTEG
GSSPLICPDSSARPRVKSSYSMENANKWSCHMCTYLNWPRAIRCTQCLSQRRTRSPTESP
QSSGSGSRPVAFSVDPCEEYNDRNKLNTRTQHWTCSVCTYENWAKAKRCVVCDHPRPNNI
EAIELAETEEASSIINEQDRARWRGSCSSGNSQRRSPPATKRDSEVKMDFQRIELAGAVG
SKEELEVDFKKLKQIKNRMKKTDWLFLNACVGVVEGDLAAIEAYKSSGGDIARQLTADEV
RLLNRPSAFDVGYTLVHLAIRFQRQDMLAILLTEVSQQAAKCIPAMVCPELTEQIRREIA
ASLHQRKGDFACYFLTDLVTFTLPADIEDLPPTVQEKLFDEVLDRDVQKELEEESPIINW
SLELATRLDSRLYALWNRTAGDCLLDSVLQATWGIYDKDSVLRKALHDSLHDCSHWFYTR
WKDWESWYSQSFGLHFSLREEQWQEDWAFILSLASQPGASLEQTHIFVLAHILRRPIIVY
GVKYYKSFRGETLGYTRFQGVYLPLLWEQSFCWKSPIALGYTRGHFSALVAMENDGYGNR
GAGANLNTDDDVTITFLPLVDSERKLLHVHFLSAQELGNEEQQEKLLREWLDCCVTEGGV
LVAMQKSSRRRNHPLVTQMVEKWLDRYRQIRPCTSLSDGEEDEDDEDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0JMQ9	0.678	0.670	0.000	716	0.798	0.789	A0JMQ9.pdb.gz	ZRN1B_DANRE Ubiquitin thioesterase zranb1-B OS=Danio rerio OX=7955 GN=zranb1b PE=2 SV=1
2	AFDB:Q9UGI0	1.000	1.000	0.000	708	1.000	1.000	Q9UGI0.pdb.gz	ZRAN1_HUMAN Ubiquitin thioesterase ZRANB1 OS=Homo sapiens OX=9606 GN=ZRANB1 PE=1 SV=2
3	AFDB:Q9VH90	0.587	0.536	4.730E-69	778	0.449	0.409	Q9VH90.pdb.gz	TRBID_DROME Ubiquitin thioesterase trabid OS=Drosophila melanogaster OX=7227 GN=trbd PE=1 SV=1
4	AFDB:A0A0R4IVZ0	0.076	0.045	3.187E-4	1436	0.073	0.036	A0A0R4IVZ0.pdb.gz	A0A0R4IVZ0_DANRE Nuclear pore complex protein Nup153 OS=Danio rerio OX=7955 GN=fd23d09 PE=1 SV=1
5	AFDB:P49791	0.070	0.042	3.986E-4	1468	0.069	0.033	P49791.pdb.gz	NU153_RAT Nuclear pore complex protein Nup153 OS=Rattus norvegicus OX=10116 GN=Nup153 PE=1 SV=1
6	AFDB:P49790	0.083	0.051	1.442E-3	1475	0.069	0.033	P49790.pdb.gz	NU153_HUMAN Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153 PE=1 SV=2
7	AFDB:P32770	0.054	0.053	1.887E-2	719	0.075	0.074	P32770.pdb.gz	DRI1_YEAST Putative RNA-binding protein involved in heterochromatin assembly OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NRP1 PE=1 SV=2
8	AFDB:Q9VXE6	0.080	0.040	5.460E-2	1883	0.072	0.027	Q9VXE6.pdb.gz	NU153_DROME Nuclear pore complex protein Nup153 OS=Drosophila melanogaster OX=7227 GN=Nup153 PE=1 SV=4
9	PDB:4ddgA	0.127	0.209	7.666E-2	399	0.068	0.120	4ddgA.pdb.gz
10	PDB:4fjvA	0.127	0.313	1.199E-1	231	0.041	0.126	4fjvA.pdb.gz	The human otubain2-ubiquitin structure provides insights into the cleavage specificity of poly-ubiquitin-linkages.
11	PDB:4dhjA	0.110	0.278	1.499E-1	248	0.037	0.105	4dhjA.pdb.gz
12	AFDB:Q9W2F3	0.057	0.039	3.455E-1	1377	0.102	0.052	Q9W2F3.pdb.gz	Q9W2F3_DROME Protein tyrosine phosphatase ERK OS=Drosophila melanogaster OX=7227 GN=PTP-ER PE=2 SV=2
13	AFDB:Q9C7M2	0.053	0.048	3.654E-1	849	0.052	0.044	Q9C7M2.pdb.gz	Q9C7M2_ARATH Uncharacterized protein F14C21.55 OS=Arabidopsis thaliana OX=3702 GN=SED1 PE=1 SV=1
14	PDB:5dizA	0.081	0.112	4.338E-1	474	0.056	0.084	5dizA.pdb.gz	Nuclear Protein-Only Ribonuclease P2 Structure and Biochemical Characterization Provide Insight into the Conserved Properties of tRNA 5' End Processing Enzymes.
15	PDB:5c8dE	0.059	0.116	7.174E-1	280	0.028	0.071	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
16	PDB:3l4gB	0.049	0.056	9.488E-1	589	0.024	0.029	3l4gB.pdb.gz	Structure of human cytosolic phenylalanyl-tRNA synthetase: evidence for kingdom-specific design of the active sites and tRNA binding patterns.
17	PDB:1xkpC	0.058	0.204	1.327	126	0.016	0.087	1xkpC.pdb.gz
18	PDB:8cs9A	0.064	0.058	1.569	796	0.021	0.019	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
19	PDB:3ehqA	0.072	0.272	1.659	182	0.013	0.049	3ehqA.pdb.gz
20	PDB:7r7jB	0.046	0.056	1.755	574	0.014	0.017	7r7jB.pdb.gz	X-ray crystal structure of the Escherichia coli RadD DNA repair protein bound to ADP reveals a novel zinc ribbon domain.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0JMQ9	0.0	1153	716	0.797	0.788	ZRN1B_DANRE Ubiquitin thioesterase zranb1-B OS=Danio rerio OX=7955 GN=zranb1b PE=2 SV=1
2	Q9UGI0	0.0	1473	708	1.000	1.000	ZRAN1_HUMAN Ubiquitin thioesterase ZRANB1 OS=Homo sapiens OX=9606 GN=ZRANB1 PE=1 SV=2
3	Q9VH90	0.0	540	778	0.439	0.400	TRBID_DROME Ubiquitin thioesterase trabid OS=Drosophila melanogaster OX=7227 GN=trbd PE=1 SV=1
4	Q60769	1.01e-33	140	775	0.141	0.129	TNAP3_MOUSE Tumor necrosis factor alpha-induced protein 3 OS=Mus musculus OX=10090 GN=Tnfaip3 PE=1 SV=2
5	P21580	1.75e-33	139	790	0.140	0.125	TNAP3_HUMAN Tumor necrosis factor alpha-induced protein 3 OS=Homo sapiens OX=9606 GN=TNFAIP3 PE=1 SV=1
6	A0JMB7	1.51e-29	127	917	0.136	0.105	A0JMB7_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=zgc:152772 PE=2 SV=1
7	Q6GQQ9	1.70e-29	127	843	0.126	0.106	OTU7B_HUMAN OTU domain-containing protein 7B OS=Homo sapiens OX=9606 GN=OTUD7B PE=1 SV=1
8	B2RUR8	4.74e-29	126	840	0.136	0.114	OTU7B_MOUSE OTU domain-containing protein 7B OS=Mus musculus OX=10090 GN=Otud7b PE=1 SV=1
9	Q8TE49	1.96e-23	108	926	0.124	0.095	OTU7A_HUMAN OTU domain-containing protein 7A OS=Homo sapiens OX=9606 GN=OTUD7A PE=1 SV=1
10	Q9ERU9	2.31e-10	67.0	3053	0.064	0.015	RBP2_MOUSE E3 SUMO-protein ligase RanBP2 OS=Mus musculus OX=10090 GN=Ranbp2 PE=1 SV=2
11	A0A8I5YC36	1.84e-08	60.8	3114	0.059	0.013	A0A8I5YC36_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=1
12	M0R3M4	1.98e-08	60.5	3089	0.059	0.014	M0R3M4_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=2
13	D4A054	2.05e-08	60.5	3061	0.059	0.014	D4A054_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=3
14	P49792	9.16e-08	58.5	3224	0.062	0.014	RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2
15	P49791	4.92e-05	49.3	1468	0.078	0.037	NU153_RAT Nuclear pore complex protein Nup153 OS=Rattus norvegicus OX=10116 GN=Nup153 PE=1 SV=1
16	O75808	0.001	44.7	1086	0.045	0.029	CAN15_HUMAN Calpain-15 OS=Homo sapiens OX=9606 GN=CAPN15 PE=1 SV=1
17	Q96EP0	0.001	45.1	1072	0.049	0.033	RNF31_HUMAN E3 ubiquitin-protein ligase RNF31 OS=Homo sapiens OX=9606 GN=RNF31 PE=1 SV=1
18	Q9VXE6	0.002	44.3	1883	0.064	0.024	NU153_DROME Nuclear pore complex protein Nup153 OS=Drosophila melanogaster OX=7227 GN=Nup153 PE=1 SV=4
19	P49790	0.004	43.1	1475	0.061	0.029	NU153_HUMAN Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153 PE=1 SV=2
20	Q924T7	0.008	42.0	1066	0.037	0.024	RNF31_MOUSE E3 ubiquitin-protein ligase RNF31 OS=Mus musculus OX=10090 GN=Rnf31 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18418 AnkUBD	9.4e-51	181.2	Ankyrin ubiquitin-binding domain
2	PF12773 DZR	83	14.6	Double zinc ribbon
3	PF02338 OTU	5.8e-35	132.0	OTU-like cysteine protease
4	PF00641 zf-RanBP	2.7e-06	37.9	Zn-finger in Ran binding protein and others

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000000844

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000001791	0.866	TNF receptor-associated factor 6, E3 ubiquitin protein ligase
2	60711.ENSCSAP00000016049	0.845	annotation not available
3	60711.ENSCSAP00000005066	0.800	annotation not available
4	60711.ENSCSAP00000014129	0.729	OTU deubiquitinase 7B
5	60711.ENSCSAP00000010276	0.723	annotation not available
6	60711.ENSCSAP00000017575	0.723	annotation not available
7	60711.ENSCSAP00000017765	0.723	annotation not available
8	60711.ENSCSAP00000001645	0.719	annotation not available
9	60711.ENSCSAP00000018444	0.719	annotation not available
10	60711.ENSCSAP00000013252	0.716	TGF-beta activated kinase 1/MAP3K7 binding protein 2
11	60711.ENSCSAP00000017123	0.716	OTU deubiquitinase 3
12	60711.ENSCSAP00000006908	0.696	Tumor necrosis factor receptor superfamily, member 1A
13	60711.ENSCSAP00000011042	0.695	APC, WNT signaling pathway regulator
14	60711.ENSCSAP00000012993	0.690	Tumor necrosis factor, alpha-induced protein 3
15	60711.ENSCSAP00000003013	0.675	Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma
16	60711.ENSCSAP00000010301	0.639	TGF-beta activated kinase 1/MAP3K7 binding protein 3
17	60711.ENSCSAP00000013304	0.637	OTU deubiquitinase with linear linkage specificity
18	60711.ENSCSAP00000007505	0.636	TNFAIP3 interacting protein 1
19	60711.ENSCSAP00000003147	0.624	OTU deubiquitinase 7A
20	60711.ENSCSAP00000000524	0.623	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070530	1.000	K63-linked polyubiquitin modification-dependent protein binding
GO:0004843	1.000	cysteine-type deubiquitinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.986	organic substance metabolic process
GO:0044238	0.985	primary metabolic process
GO:0044237	0.985	cellular metabolic process
GO:0006807	0.977	nitrogen compound metabolic process
GO:0050794	0.970	regulation of cellular process
GO:0043170	0.966	macromolecule metabolic process
GO:0070647	0.950	protein modification by small protein conjugation or removal
GO:0048583	0.948	regulation of response to stimulus
GO:0044260	0.948	cellular macromolecule metabolic process
GO:0006508	0.947	proteolysis
GO:0023051	0.946	regulation of signaling
GO:0010646	0.946	regulation of cell communication
GO:0048518	0.944	positive regulation of biological process
GO:0009966	0.944	regulation of signal transduction
GO:0070646	0.934	protein modification by small protein removal
GO:0019941	0.924	modification-dependent protein catabolic process
GO:0006511	0.911	ubiquitin-dependent protein catabolic process
GO:0048522	0.905	positive regulation of cellular process
GO:0016579	0.880	protein deubiquitination
GO:0071840	0.791	cellular component organization or biogenesis
GO:0016043	0.776	cellular component organization
GO:0009967	0.696	positive regulation of signal transduction
GO:0030111	0.688	regulation of Wnt signaling pathway
GO:0006996	0.532	organelle organization
GO:0048856	0.490	anatomical structure development
GO:0048523	0.471	negative regulation of cellular process
GO:0007275	0.390	multicellular organism development
GO:0050793	0.381	regulation of developmental process
GO:0060255	0.320	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005654	0.997	nucleoplasm
GO:0012505	0.717	endomembrane system
GO:0031982	0.504	vesicle
GO:0016020	0.352	membrane
GO:0005768	0.339	endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]