StarFunc result for job id Q9UGI6

User Input

>input (731 residues)
MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQQQQQQQQPPPPAPPAAPQQPLGPSLQ
PQPPQLQQQQQQQQQQQQQQPPHPLSQLAQLQSQPVHPGLLHSSPTAFRAPPSSNSTAIL
HPSSRQGSQLNLNDHLLGHSPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCKY
SGGVMKPLSRLSASRRNLIEAETEGQPLQLFSPSNPPEIVISSREDNHAHQTLLHHPNAT
HNHQHAGTTASSTTFPKANKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVI
ETELSWGLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTY
ERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIAR
VMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRV
CERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVA
VVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKH
QRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLE
SKLEHLTASFNSLPLLIADTLRQQQQQLLSAIIEARGVSVAVGTTHTPISDSPIGVSSTS
FPTPYTSSSSC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P58391	0.768	0.767	1.926E-87	732	0.959	0.958	P58391.pdb.gz	KCNN3_MOUSE Small conductance calcium-activated potassium channel protein 3 OS=Mus musculus OX=10090 GN=Kcnn3 PE=1 SV=2
2	AFDB:P58390	0.598	0.522	7.799E-62	839	0.659	0.574	P58390.pdb.gz	KCNN2_MOUSE Small conductance calcium-activated potassium channel protein 2 OS=Mus musculus OX=10090 GN=Kcnn2 PE=1 SV=2
3	AFDB:Q9EQR3	0.584	0.784	5.119E-53	537	0.477	0.650	Q9EQR3.pdb.gz	KCNN1_MOUSE Small conductance calcium-activated potassium channel protein 1 OS=Mus musculus OX=10090 GN=Kcnn1 PE=1 SV=2
4	AFDB:Q7KVW5	0.599	0.475	2.089E-47	927	0.461	0.364	Q7KVW5.pdb.gz	KCNN_DROME Small conductance calcium-activated potassium channel protein OS=Drosophila melanogaster OX=7227 GN=SK PE=2 SV=2
5	PDB:6cnnA	0.449	0.886	5.400E-26	360	0.234	0.475	6cnnA.pdb.gz	Activation mechanism of a human SK-calmodulin channel complex elucidated by cryo-EM structures.
6	PDB:7bylA	0.133	0.244	1.079E-6	354	0.082	0.169	7bylA.pdb.gz	Structural Basis for the Modulation of Human KCNQ4 by Small-Molecule Drugs.
7	PDB:7vnrA	0.145	0.259	5.905E-6	333	0.077	0.168	7vnrA.pdb.gz	Structural insights into the lipid and ligand regulation of a human neuronal KCNQ channel.
8	PDB:7w6sB	0.148	0.212	2.047E-4	448	0.089	0.145	7w6sB.pdb.gz
9	PDB:7f3fA	0.133	0.203	4.241E-4	460	0.075	0.120	7f3fA.pdb.gz
10	AFDB:Q8NEC5	0.112	0.106	1.565E-3	780	0.135	0.127	Q8NEC5.pdb.gz	CTSR1_HUMAN Cation channel sperm-associated protein 1 OS=Homo sapiens OX=9606 GN=CATSPER1 PE=1 SV=3
11	PDB:7phhA	0.107	0.187	1.574E-3	396	0.066	0.121	7phhA.pdb.gz
12	PDB:7sizB	0.126	0.240	6.757E-3	334	0.068	0.150	7sizB.pdb.gz	Structural basis for C-type inactivation in a Shaker family voltage-gated K + channel.
13	PDB:7calA	0.187	0.277	1.046E-2	444	0.071	0.117	7calA.pdb.gz
14	PDB:7pquA	0.114	0.243	1.210E-2	328	0.062	0.137	7pquA.pdb.gz
15	PDB:3lutB	0.109	0.200	1.470E-2	390	0.057	0.108	3lutB.pdb.gz	Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.
16	AFDB:Q22257	0.091	0.057	2.156E-2	1295	0.120	0.068	Q22257.pdb.gz	Q22257_CAEEL HoloCentric chromosome binding Protein OS=Caenorhabditis elegans OX=6239 GN=hcp-2 PE=1 SV=1
17	AFDB:Q0KHQ5	0.098	0.075	3.503E-2	1039	0.127	0.090	Q0KHQ5.pdb.gz	TAO_DROME Serine/threonine-protein kinase Tao OS=Drosophila melanogaster OX=7227 GN=Tao PE=1 SV=1
18	AFDB:D3ZK73	0.066	0.058	3.861E-2	971	0.122	0.092	D3ZK73.pdb.gz	D3ZK73_RAT Cullin 4B OS=Rattus norvegicus OX=10116 GN=Cul4b PE=1 SV=1
19	AFDB:A0A0B4LFI1	0.101	0.068	4.053E-2	1089	0.105	0.071	A0A0B4LFI1.pdb.gz	A0A0B4LFI1_DROME Stac-like, isoform U OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
20	AFDB:B8PWL7	0.066	0.053	4.255E-2	994	0.149	0.110	B8PWL7.pdb.gz	B8PWL7_DANRE Disrupted in schizophrenia 1 OS=Danio rerio OX=7955 GN=disc1 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P58391	0.0	1345	732	0.940	0.939	KCNN3_MOUSE Small conductance calcium-activated potassium channel protein 3 OS=Mus musculus OX=10090 GN=Kcnn3 PE=1 SV=2
2	P70604	0.0	834	580	0.561	0.707	KCNN2_RAT Small conductance calcium-activated potassium channel protein 2 OS=Rattus norvegicus OX=10116 GN=Kcnn2 PE=1 SV=1
3	P70605	0.0	1345	732	0.941	0.940	KCNN3_RAT Small conductance calcium-activated potassium channel protein 3 OS=Rattus norvegicus OX=10116 GN=Kcnn3 PE=2 SV=3
4	P70606	0.0	711	536	0.451	0.616	KCNN1_RAT Small conductance calcium-activated potassium channel protein 1 OS=Rattus norvegicus OX=10116 GN=Kcnn1 PE=1 SV=2
5	Q7KVW5	0.0	617	927	0.416	0.328	KCNN_DROME Small conductance calcium-activated potassium channel protein OS=Drosophila melanogaster OX=7227 GN=SK PE=2 SV=2
6	Q92952	0.0	730	543	0.468	0.630	KCNN1_HUMAN Small conductance calcium-activated potassium channel protein 1 OS=Homo sapiens OX=9606 GN=KCNN1 PE=1 SV=2
7	Q9EQR3	0.0	707	537	0.450	0.613	KCNN1_MOUSE Small conductance calcium-activated potassium channel protein 1 OS=Mus musculus OX=10090 GN=Kcnn1 PE=1 SV=2
8	Q9H2S1	0.0	839	579	0.562	0.710	KCNN2_HUMAN Small conductance calcium-activated potassium channel protein 2 OS=Homo sapiens OX=9606 GN=KCNN2 PE=1 SV=2
9	Q9UGI6	0.0	1513	731	1.000	1.000	KCNN3_HUMAN Small conductance calcium-activated potassium channel protein 3 OS=Homo sapiens OX=9606 GN=KCNN3 PE=1 SV=2
10	V6CLK4	1.39e-132	415	855	0.286	0.244	V6CLK4_CAEEL Calmodulin-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=kcnl-2 PE=4 SV=1
11	O89109	1.78e-102	322	425	0.260	0.447	KCNN4_MOUSE Intermediate conductance calcium-activated potassium channel protein 4 OS=Mus musculus OX=10090 GN=Kcnn4 PE=2 SV=1
12	Q9QYW1	4.83e-101	319	425	0.257	0.442	KCNN4_RAT Intermediate conductance calcium-activated potassium channel protein 4 OS=Rattus norvegicus OX=10116 GN=Kcnn4 PE=2 SV=2
13	O15554	8.09e-100	316	427	0.256	0.438	KCNN4_HUMAN Intermediate conductance calcium-activated potassium channel protein 4 OS=Homo sapiens OX=9606 GN=KCNN4 PE=1 SV=1
14	D1MQ08	2.30e-69	231	295	0.172	0.427	D1MQ08_HUMAN Small conductance calcium activated potassium channel type 4 transcript variant 2 OS=Homo sapiens OX=9606 GN=KCNN4 PE=2 SV=1
15	Q99415	8.99e-23	99.8	228	0.142	0.456	Q99415_HUMAN AAD14 protein (Fragment) OS=Homo sapiens OX=9606 GN=AAD14 PE=2 SV=1
16	A1Z856	5.62e-07	55.5	993	0.045	0.033	A1Z856_DROME KCNQ potassium channel, isoform F OS=Drosophila melanogaster OX=7227 GN=KCNQ PE=4 SV=2
17	A0A0B4KEI9	6.79e-07	55.5	823	0.045	0.040	A0A0B4KEI9_DROME KCNQ potassium channel, isoform H OS=Drosophila melanogaster OX=7227 GN=KCNQ PE=4 SV=1
18	A0A0B4KEP9	7.54e-07	55.1	827	0.045	0.040	A0A0B4KEP9_DROME KCNQ potassium channel, isoform J OS=Drosophila melanogaster OX=7227 GN=KCNQ PE=4 SV=1
19	A0A0B4KF62	8.49e-07	55.1	805	0.045	0.041	A0A0B4KF62_DROME KCNQ potassium channel, isoform G OS=Drosophila melanogaster OX=7227 GN=KCNQ PE=4 SV=1
20	Q5PXF9	8.65e-07	55.1	808	0.045	0.041	Q5PXF9_DROME KCNQ potassium channel, isoform E OS=Drosophila melanogaster OX=7227 GN=KCNQ PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02888 CaMBD	6e-34	127.1	Calmodulin binding domain
2	PF20565 DUF6775	50	14.8	Probable metallopeptidase family (DUF6775)
3	PF07885 Ion_trans_2	2.5e-09	48.3	Ion channel
4	PF03530 SK_channel	1.2e-45	165.7	Calcium-activated SK potassium channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010362985.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010361537.1	0.920	Potassium calcium-activated channel subfamily M alpha 1
2	61622.XP_010357019.1	0.915	Calcium-activated potassium channel subunit beta-4
3	61622.XP_010372312.1	0.867	Calcium-activated potassium channel subunit beta-2
4	61622.XP_010363176.1	0.864	Calcium-activated potassium channel subunit beta-1
5	61622.XP_010374465.1	0.830	Small conductance calcium-activated potassium channel protein 2
6	61622.XP_010384929.1	0.829	Small conductance calcium-activated potassium channel protein 1
7	61622.XP_010372274.1	0.825	Potassium calcium-activated channel subfamily M regulatory beta subunit 3
8	61622.XP_010370748.1	0.812	Potassium calcium-activated channel subfamily N member 4
9	61622.XP_010366633.1	0.740	Calcium release-activated calcium channel protein 1
10	61622.XP_010377744.1	0.702	Transient receptor potential cation channel subfamily V member 4
11	61622.XP_010366179.1	0.639	Protein kinase C beta type isoform X1
12	61622.XP_010379008.1	0.639	Protein kinase C gamma type isoform X1
13	61622.XP_010378287.1	0.637	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
14	61622.XP_010370878.1	0.585	Pygopus family PHD finger 1
15	61622.XP_010372393.1	0.585	ANKH inorganic pyrophosphate transport regulator
16	61622.XP_010382155.1	0.567	Kappa-casein stabilizes micelle formation, preventing casein precipitation in milk
17	61622.XP_010361255.1	0.560	Belongs to the calmodulin family.
18	61622.XP_010362597.1	0.560	Calmodulin
19	61622.XP_010372142.1	0.560	Calmodulin
20	61622.XP_010375732.1	0.560	Belongs to the calmodulin family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016286	0.999	small conductance calcium-activated potassium channel activity
GO:0005516	0.743	calmodulin binding
GO:0022843	0.665	voltage-gated monoatomic cation channel activity
GO:0005249	0.371	voltage-gated potassium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006813	0.995	potassium ion transport
GO:0009987	0.981	cellular process
GO:0034220	0.781	monoatomic ion transmembrane transport
GO:0098662	0.765	inorganic cation transmembrane transport
GO:0098655	0.763	monoatomic cation transmembrane transport
GO:0065007	0.664	biological regulation
GO:0071805	0.508	potassium ion transmembrane transport
GO:0050789	0.481	regulation of biological process
GO:0050794	0.357	regulation of cellular process
GO:0065008	0.326	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.756	intracellular anatomical structure
GO:0005737	0.741	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]