StarFunc result for job id Q9UGI8

User Input

>input (421 residues)
MDLENKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEED
RKVGKLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQ
ALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVK
KYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCK
LSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPR
CAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVV
CQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRM
S

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4D0U5	0.835	0.835	3.155E-83	421	1.000	1.000	A4D0U5.pdb.gz	A4D0U5_HUMAN Testin OS=Homo sapiens OX=9606 GN=TES PE=3 SV=1
2	AFDB:Q7ZXE9	0.891	0.889	1.396E-73	422	0.817	0.815	Q7ZXE9.pdb.gz	TES_XENLA Testin OS=Xenopus laevis OX=8355 GN=tes PE=2 SV=1
3	AFDB:P47226	0.859	0.855	2.116E-72	423	0.846	0.842	P47226.pdb.gz	TES_MOUSE Testin OS=Mus musculus OX=10090 GN=Tes PE=1 SV=1
4	AFDB:Q8VEE1	0.716	0.821	1.633E-43	365	0.420	0.485	Q8VEE1.pdb.gz	LMCD1_MOUSE LIM and cysteine-rich domains protein 1 OS=Mus musculus OX=10090 GN=Lmcd1 PE=1 SV=1
5	AFDB:A0A2R8Q2U1	0.693	0.343	6.763E-40	900	0.349	0.163	A0A2R8Q2U1.pdb.gz
6	AFDB:O43900	0.696	0.490	2.151E-39	615	0.356	0.244	O43900.pdb.gz	PRIC3_HUMAN Prickle planar cell polarity protein 3 OS=Homo sapiens OX=9606 GN=PRICKLE3 PE=1 SV=2
7	AFDB:Q80VL3	0.692	0.480	1.219E-38	624	0.356	0.240	Q80VL3.pdb.gz	PRIC3_MOUSE Prickle planar cell polarity protein 3 OS=Mus musculus OX=10090 GN=Prickle3 PE=1 SV=1
8	AFDB:Q90Z06	0.569	0.301	2.608E-32	835	0.280	0.141	Q90Z06.pdb.gz	PRI1A_XENLA Prickle-like protein 1-A OS=Xenopus laevis OX=8355 GN=prickle1-a PE=1 SV=1
9	AFDB:Q3U5C7	0.559	0.296	5.860E-32	832	0.280	0.142	Q3U5C7.pdb.gz	PRIC1_MOUSE Prickle-like protein 1 OS=Mus musculus OX=10090 GN=Prickle1 PE=1 SV=1
10	AFDB:F2Z4V3	0.570	0.286	6.209E-32	872	0.283	0.136	F2Z4V3.pdb.gz	F2Z4V3_DANRE Prickle homolog 1b OS=Danio rerio OX=7955 GN=fb98c11 PE=3 SV=1
11	PDB:4kfzB	0.176	0.417	1.484E-7	148	0.062	0.176	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
12	PDB:1b8tA	0.140	0.288	8.698E-4	192	0.069	0.151	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:1imlA	0.126	0.552	1.058E-1	76	0.038	0.211	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
14	PDB:5dxhD	0.068	0.033	1.428	981	0.036	0.015	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
15	PDB:3zxuA	0.062	0.105	1.907	211	0.043	0.085	3zxuA.pdb.gz	Rwd Domain: A Recurring Module in Kinetochore Architecture Shown by a Ctf19-Mcm21 Complex Structure.
16	PDB:5xblA	0.063	0.028	2.859	1320	0.045	0.014	5xblA.pdb.gz	Structural basis of CRISPR-SpyCas9 inhibition by an anti-CRISPR protein
17	PDB:7pntF	0.050	0.082	2.859	208	0.033	0.067	7pntF.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
18	PDB:6jp8F	0.057	0.031	3.029	973	0.074	0.032	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
19	PDB:3p9aA	0.069	0.165	3.400	139	0.031	0.094	3p9aA.pdb.gz
20	PDB:6h3cA	0.056	0.091	3.400	255	0.024	0.039	6h3cA.pdb.gz	Structural Basis of BRCC36 Function in DNA Repair and Immune Regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4D0U5	0.0	878	421	1.000	1.000	A4D0U5_HUMAN Testin OS=Homo sapiens OX=9606 GN=TES PE=3 SV=1
2	P47226	0.0	729	423	0.836	0.832	TES_MOUSE Testin OS=Mus musculus OX=10090 GN=Tes PE=1 SV=1
3	Q2LAP6	0.0	814	419	0.931	0.936	TES_RAT Testin OS=Rattus norvegicus OX=10116 GN=Tes PE=1 SV=1
4	Q7ZXE9	0.0	732	422	0.819	0.818	TES_XENLA Testin OS=Xenopus laevis OX=8355 GN=tes PE=2 SV=1
5	Q9UGI8	0.0	878	421	1.000	1.000	TES_HUMAN Testin OS=Homo sapiens OX=9606 GN=TES PE=1 SV=1
6	Q9NZU5	1.95e-128	377	365	0.432	0.499	LMCD1_HUMAN LIM and cysteine-rich domains protein 1 OS=Homo sapiens OX=9606 GN=LMCD1 PE=1 SV=1
7	Q8VEE1	9.29e-127	372	365	0.432	0.499	LMCD1_MOUSE LIM and cysteine-rich domains protein 1 OS=Mus musculus OX=10090 GN=Lmcd1 PE=1 SV=1
8	Q9Y423	1.03e-97	290	136	0.323	1.000	Q9Y423_HUMAN Uncharacterized protein DKFZp586B2022 (Fragment) OS=Homo sapiens OX=9606 GN=DKFZp586B2022 PE=2 SV=1
9	Q80VL3	8.78e-82	265	624	0.359	0.242	PRIC3_MOUSE Prickle planar cell polarity protein 3 OS=Mus musculus OX=10090 GN=Prickle3 PE=1 SV=1
10	O43900	1.62e-81	264	615	0.352	0.241	PRIC3_HUMAN Prickle planar cell polarity protein 3 OS=Homo sapiens OX=9606 GN=PRICKLE3 PE=1 SV=2
11	Q80Y24	5.33e-72	244	845	0.287	0.143	PRIC2_MOUSE Prickle-like protein 2 OS=Mus musculus OX=10090 GN=Prickle2 PE=1 SV=3
12	Q7Z3G6	1.07e-71	243	844	0.287	0.143	PRIC2_HUMAN Prickle-like protein 2 OS=Homo sapiens OX=9606 GN=PRICKLE2 PE=1 SV=2
13	Q7ZZC4	2.68e-71	242	840	0.283	0.142	Q7ZZC4_DANRE Prickle-like protein 2 OS=Danio rerio OX=7955 GN=pk2 PE=2 SV=1
14	F1REQ6	2.85e-71	241	840	0.283	0.142	F1REQ6_DANRE Prickle homolog 2b OS=Danio rerio OX=7955 GN=cb886 PE=3 SV=1
15	Q5SP54	1.72e-70	240	863	0.283	0.138	Q5SP54_DANRE Prickle homolog 1b OS=Danio rerio OX=7955 GN=fb98c11 PE=3 SV=2
16	F2Z4V3	2.20e-70	239	872	0.283	0.136	F2Z4V3_DANRE Prickle homolog 1b OS=Danio rerio OX=7955 GN=fb98c11 PE=3 SV=1
17	Q3U5C7	1.67e-69	237	832	0.285	0.144	PRIC1_MOUSE Prickle-like protein 1 OS=Mus musculus OX=10090 GN=Prickle1 PE=1 SV=1
18	Q96MT3	6.76e-69	235	831	0.283	0.143	PRIC1_HUMAN Prickle-like protein 1 OS=Homo sapiens OX=9606 GN=PRICKLE1 PE=1 SV=2
19	Q9U1I1	1.67e-68	233	785	0.276	0.148	ESN_DROME Protein espinas OS=Drosophila melanogaster OX=7227 GN=esn PE=2 SV=1
20	Q71QF9	2.14e-68	234	831	0.283	0.143	PRIC1_RAT Prickle-like protein 1 OS=Rattus norvegicus OX=10116 GN=Prickle1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10430 Ig_Tie2_1	1.9e+02	13.8	Tie-2 Ig-like domain 1
2	PF00412 LIM	7.4e-25	98.3	LIM domain
3	PF06297 PET	8.8e-38	139.7	PET Domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350937

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355809	0.977	Protein enabled homolog
2	9606.ENSP00000334300	0.935	Actin-like protein 7A
3	9606.ENSP00000245932	0.861	Vasodilator-stimulated phosphoprotein
4	9606.ENSP00000356814	0.806	DDB1- and CUL4-associated factor 6
5	9606.ENSP00000324422	0.764	Zyxin
6	9606.ENSP00000362201	0.747	Testican-2
7	9606.ENSP00000349677	0.737	Testican-3
8	9606.ENSP00000370115	0.729	Leukocyte elastase inhibitor
9	9606.ENSP00000363852	0.704	Choline transporter-like protein 1
10	9606.ENSP00000295897	0.683	Serum albumin
11	9606.ENSP00000385995	0.680	Thyroid adenoma-associated protein
12	9606.ENSP00000361824	0.667	Spectrin alpha chain, non-erythrocytic 1
13	9606.ENSP00000227322	0.658	Zinc finger protein ZPR1
14	9606.ENSP00000378401	0.656	Testican-1
15	9606.ENSP00000369456	0.652	Inosine triphosphate pyrophosphatase
16	9606.ENSP00000286614	0.647	Matrix metalloproteinase-16
17	9606.ENSP00000369643	0.647	Gastrin-releasing peptide receptor
18	9606.ENSP00000215838	0.633	Transcobalamin-2
19	9606.ENSP00000360252	0.608	Protein Hook homolog 1
20	9606.ENSP00000003084	0.588	Cystic fibrosis transmembrane conductance regulator

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0009987	0.886	cellular process
GO:0048519	0.826	negative regulation of biological process
GO:0048523	0.764	negative regulation of cellular process
GO:0042127	0.738	regulation of cell population proliferation
GO:0048856	0.647	anatomical structure development
GO:0048518	0.389	positive regulation of biological process
GO:0008285	0.383	negative regulation of cell population proliferation
GO:0050896	0.365	response to stimulus
GO:0048522	0.360	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0071944	0.995	cell periphery
GO:0005829	0.995	cytosol
GO:0005886	0.983	plasma membrane
GO:0043227	0.980	membrane-bounded organelle
GO:0043231	0.972	intracellular membrane-bounded organelle
GO:0005925	0.950	focal adhesion
GO:0005634	0.927	nucleus
GO:0032991	0.714	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]