StarFunc result for job id Q9UGK3

User Input

>input (403 residues)
MASALRPPRVPKPKGVLPSHYYESFLEKKGPCDRDYKKFWAGLQGLTIYFYNSNRDFQHV
EKLNLGAFEKLTDEIPWGSSRDPGTHFSLILRDQEIKFKVETLECREMWKGFILTVVELR
VPTDLTLLPGHLYMMSEVLAKEEARRALETPSCFLKVSRLEAQLLLERYPECGNLLLRPS
GDGADGVSVTTRQMHNGTHVVRHYKVKREGPKYVIDVEQPFSCTSLDAVVNYFVSHTKKA
LVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAPCTGGPKPLSPASSQDKLPPL
PPLPNQEENYVTPIGDGPAVDYENQDVASSSWPVILKPKKLPKPPAKLPKPPVGPKPEPK
VFNGGLGRKLPVSSAQPLFPTAGLADMTAELQKKLEKRRALEH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UGK3	1.000	1.000	4.907E-72	403	1.000	1.000	Q9UGK3.pdb.gz	STAP2_HUMAN Signal-transducing adaptor protein 2 OS=Homo sapiens OX=9606 GN=STAP2 PE=1 SV=2
2	AFDB:Q8R0L1	0.644	0.632	6.563E-54	411	0.702	0.689	Q8R0L1.pdb.gz	STAP2_MOUSE Signal-transducing adaptor protein 2 OS=Mus musculus OX=10090 GN=Stap2 PE=1 SV=1
3	PDB:7c3mA	0.185	0.133	4.437E-6	577	0.117	0.081	7c3mA.pdb.gz
4	AFDB:Q8K124	0.247	0.206	8.628E-6	495	0.156	0.127	Q8K124.pdb.gz	PKHO2_MOUSE Pleckstrin homology domain-containing family O member 2 OS=Mus musculus OX=10090 GN=Plekho2 PE=1 SV=1
5	PDB:3ljuX	0.221	0.238	2.378E-5	373	0.047	0.051	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
6	AFDB:Q80VL0	0.206	0.204	3.462E-5	406	0.117	0.116	Q80VL0.pdb.gz	ICEF1_RAT Interactor protein for cytohesin exchange factors 1 OS=Rattus norvegicus OX=10116 GN=Ipcef1 PE=1 SV=1
7	PDB:6bbpA	0.213	0.167	8.019E-5	520	0.055	0.042	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
8	AFDB:Q9QYY0	0.225	0.133	1.389E-4	695	0.129	0.075	Q9QYY0.pdb.gz	GAB1_MOUSE GRB2-associated-binding protein 1 OS=Mus musculus OX=10090 GN=Gab1 PE=1 SV=2
9	PDB:6u3eA	0.201	0.203	2.273E-4	397	0.055	0.055	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
10	AFDB:Q7Z5H3	0.203	0.122	4.963E-4	698	0.151	0.087	Q7Z5H3.pdb.gz	RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens OX=9606 GN=ARHGAP22 PE=1 SV=1
11	AFDB:Q9BRG2	0.177	0.127	7.024E-4	576	0.134	0.094	Q9BRG2.pdb.gz	SH23A_HUMAN SH2 domain-containing protein 3A OS=Homo sapiens OX=9606 GN=SH2D3A PE=1 SV=1
12	PDB:3ps5A	0.188	0.145	7.667E-4	529	0.072	0.055	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
13	PDB:7rx9A	0.210	0.197	8.123E-4	432	0.037	0.035	7rx9A.pdb.gz
14	PDB:4gwfA	0.204	0.168	9.121E-4	497	0.067	0.054	4gwfA.pdb.gz
15	AFDB:A8MS85	0.191	0.052	9.382E-4	1647	0.122	0.030	A8MS85.pdb.gz	SPT61_ARATH Transcription elongation factor SPT6 homolog OS=Arabidopsis thaliana OX=3702 GN=SPT6 PE=1 SV=1
16	PDB:4fl2A	0.198	0.151	1.150E-3	555	0.082	0.059	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
17	PDB:1k9aB	0.197	0.183	1.291E-3	441	0.077	0.070	1k9aB.pdb.gz
18	PDB:5xzrA	0.191	0.153	1.449E-3	519	0.084	0.066	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
19	AFDB:Q91VS8	0.217	0.086	2.137E-2	1065	0.057	0.022	Q91VS8.pdb.gz	FARP2_MOUSE FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Farp2 PE=1 SV=2
20	AFDB:Q49AR9	0.170	0.127	2.400E-2	570	0.141	0.100	Q49AR9.pdb.gz	Q49AR9_HUMAN ANKS1A protein OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8R0L1	0.0	514	411	0.702	0.689	STAP2_MOUSE Signal-transducing adaptor protein 2 OS=Mus musculus OX=10090 GN=Stap2 PE=1 SV=1
2	Q9UGK3	0.0	822	403	1.000	1.000	STAP2_HUMAN Signal-transducing adaptor protein 2 OS=Homo sapiens OX=9606 GN=STAP2 PE=1 SV=2
3	Q9ULZ2	5.59e-44	156	295	0.233	0.319	STAP1_HUMAN Signal-transducing adaptor protein 1 OS=Homo sapiens OX=9606 GN=STAP1 PE=1 SV=1
4	Q9JM90	2.12e-41	150	297	0.236	0.320	STAP1_MOUSE Signal-transducing adaptor protein 1 OS=Mus musculus OX=10090 GN=Stap1 PE=1 SV=1
5	P24135	0.030	39.3	1265	0.065	0.021	PLCG2_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Rattus norvegicus OX=10116 GN=Plcg2 PE=1 SV=1
6	P00528	0.71	34.7	552	0.077	0.056	SRC64_DROME Tyrosine-protein kinase Src64B OS=Drosophila melanogaster OX=7227 GN=Src64B PE=1 SV=3
7	Q96WV2	0.77	34.3	339	0.045	0.053	YJO2_SCHPO Uncharacterized PH domain-containing protein PB16A4.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCPB16A4.02c PE=4 SV=2
8	P90761	1.7	33.5	1693	0.040	0.009	STNB_CAEEL Putative stoned B-like protein OS=Caenorhabditis elegans OX=6239 GN=unc-41 PE=3 SV=2
9	M9PC48	1.8	33.5	18095	0.082	0.002	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
10	M9PCJ6	1.8	33.5	18641	0.082	0.002	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
11	Q9W4M4	2.7	32.7	1357	0.065	0.019	Q9W4M4_DROME Uncharacterized protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG15570 PE=1 SV=1
12	M9PB30	3.6	32.7	22949	0.082	0.001	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
13	M9PBZ0	3.6	32.7	22830	0.082	0.001	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
14	M9PC41	3.6	32.7	22743	0.082	0.001	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
15	M9PC45	3.6	32.7	22300	0.082	0.001	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
16	M9PEH5	3.6	32.7	20710	0.082	0.002	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	M9PEI1	3.6	32.7	21657	0.082	0.002	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	P04821	4.3	32.3	1589	0.060	0.015	CDC25_YEAST Cell division control protein 25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC25 PE=1 SV=1
19	M9PB31	5.2	32.0	20404	0.082	0.002	M9PB31_DROME Dumpy, isoform V OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	G5EEV7	5.8	32.0	1782	0.047	0.011	G5EEV7_CAEEL Raptor N-terminal CASPase-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=daf-15 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00017 SH2	0.93	21.0	SH2 domain
2	PF14633 SH2_2	2e+02	12.8	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003819325.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003809959.1	0.874	Protein-tyrosine kinase 6
2	9597.XP_008964734.1	0.846	Signal transducer and activator of transcription 3
3	9597.XP_003829077.1	0.759	Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
4	9597.NP_001266118.1	0.715	Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response. Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Increases IL-8 transcription. Involved in IL-18-mediated signaling pathway. Activates IRF1 resulting in its rapid migration into the nucleus to mediate an efficient induction of IFN-beta, NOS2/INOS, and IL12A genes (By similarity). MyD88-mediated signaling in intestinal epithelial cells is crucial for maintenance of gut homeostasis and controls the [...]
5	9597.XP_003809960.1	0.667	Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites
6	9597.XP_003813365.1	0.664	HID1 domain containing
7	9597.XP_003813367.1	0.657	Otopetrin 2
8	9597.XP_003813366.1	0.653	Otopetrin-3 isoform X1
9	9597.XP_008964732.1	0.650	Signal transducer and activator of transcription 5B
10	9597.XP_003813364.1	0.603	Cerebellar degeneration-related protein 2-like isoform X1
11	9597.XP_003816534.1	0.592	Transmembrane protein 128 isoform X1
12	9597.XP_008965308.1	0.585	SH2 domain containing 5
13	9597.XP_008959577.1	0.583	Dedicator of cytokinesis protein 7 isoform X1
14	9597.XP_003827610.1	0.574	Fyn related Src family tyrosine kinase
15	9597.XP_003816533.1	0.541	Otopetrin 1
16	9597.XP_008962446.1	0.541	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon
17	9597.XP_008957199.1	0.539	Leptin receptor
18	9597.XP_003819385.1	0.534	Solute carrier family 25 member 23
19	9597.XP_008962687.1	0.534	Exocyst complex component 3
20	9597.XP_003813928.1	0.504	Signal transducer and activator of transcription 5A isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.347	enzyme binding
GO:0005102	0.322	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048522	0.995	positive regulation of cellular process
GO:0050896	0.990	response to stimulus
GO:0009987	0.988	cellular process
GO:0048584	0.983	positive regulation of response to stimulus
GO:0019222	0.974	regulation of metabolic process
GO:0002682	0.969	regulation of immune system process
GO:0051716	0.935	cellular response to stimulus
GO:0050776	0.924	regulation of immune response
GO:0007154	0.879	cell communication
GO:0023052	0.875	signaling
GO:0023051	0.855	regulation of signaling
GO:0009966	0.854	regulation of signal transduction
GO:0007165	0.829	signal transduction
GO:0031323	0.812	regulation of cellular metabolic process
GO:0002684	0.704	positive regulation of immune system process
GO:0060255	0.686	regulation of macromolecule metabolic process
GO:0002376	0.641	immune system process
GO:0048519	0.619	negative regulation of biological process
GO:0048523	0.613	negative regulation of cellular process
GO:0051239	0.592	regulation of multicellular organismal process
GO:0009893	0.577	positive regulation of metabolic process
GO:0042221	0.573	response to chemical
GO:0010604	0.555	positive regulation of macromolecule metabolic process
GO:0010468	0.504	regulation of gene expression
GO:0010033	0.503	response to organic substance
GO:0007166	0.484	cell surface receptor signaling pathway
GO:0080090	0.444	regulation of primary metabolic process
GO:0008152	0.437	metabolic process
GO:0070887	0.414	cellular response to chemical stimulus
GO:0031325	0.386	positive regulation of cellular metabolic process
GO:0051171	0.383	regulation of nitrogen compound metabolic process
GO:0044237	0.376	cellular metabolic process
GO:0071310	0.365	cellular response to organic substance
GO:0051173	0.342	positive regulation of nitrogen compound metabolic process
GO:0042325	0.336	regulation of phosphorylation
GO:0071704	0.321	organic substance metabolic process
GO:0032501	0.318	multicellular organismal process
GO:0040012	0.314	regulation of locomotion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005829	0.998	cytosol
GO:0043231	0.938	intracellular membrane-bounded organelle
GO:0070013	0.744	intracellular organelle lumen
GO:0005634	0.735	nucleus
GO:0031981	0.720	nuclear lumen
GO:0005654	0.702	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]