StarFunc result for job id Q9UGL1

User Input

>input (1544 residues)
MEAATTLHPGPRPALPLGGPGPLGEFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTG
ICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKLNFLDQIAKYWELQGSTLKI
PHVERKILDLFQLNKLVAEEGGFAVVCKDRKWTKIATKMGFAPGKAVGSHIRGHYERILN
PYNLFLSGDSLRCLQKPNLTTDTKDKEYKPHDIPQRQSVQPSETCPPARRAKRMRAEAMN
IKIEPEETTEARTHNLRRRMGCPTPKCENEKEMKSSIKQEPIERKDYIVENEKEKPKSRS
KKATNAVDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGDWRCPKCLAQE
CSKPQEAFGFEQAARDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEED
VTVEYGADIASKEFGSGFPVRDGKIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADIC
GMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPE
LFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAV
NFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIE
DEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVK
ELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAESYNEWALNVNEALEAKINKKKSLVSFK
ALIEESEMKKFPDNDLLRHLRLVTQDAEKCASVAQQLLNGKRQTRYRSGGGKSQNQLTVN
ELRQFVTQLYALPCVLSQTPLLKDLLNRVEDFQQHSQKLLSEETPSAAELQDLLDVSFEF
DVELPQLAEMRIRLEQARWLEEVQQACLDPSSLTLDDMRRLIDLGVGLAPYSAVEKAMAR
LQELLTVSEHWDDKAKSLLKARPRHSLNSLATAVKEIEEIPAYLPNGAALKDSVQRARDW
LQDVEGLQAGGRVPVLDTLIELVTRGRSIPVHLNSLPRLETLVAEVQAWKECAVNTFLTE
NSPYSLLEVLCPRCDIGLLGLKRKQRKLKEPLPNGKKKSTKLESLSDLERALTESKETAS
AMATLGEARLREMEALQSLRLANEGKLLSPLQDVDIKICLCQKAPAAPMIQCELCRDAFH
TSCVAVPSISQGLRIWLCPHCRRSEKPPLEKILPLLASLQRIRVRLPEGDALRYMIERTV
NWQHRAQQLLSSGNLKFVQDRVGSGLLYSRWQASAGQVSDTNKVSQPPGTTSFSLPDDWD
NRTSYLHSPFSTGRSCIPLHGVSPEVNELLMEAQLLQVSLPEIQELYQTLLAKPSPAQQT
DRSSPVRPSSEKNDCCRGKRDGINSLERKLKRRLEREGLSSERWERVKKMRTPKKKKIKL
SHPKDMNNFKLERERSYELVRSAETHSLPSDTSYSEQEDSEDEDAICPAVSCLQPEGDEV
DWVQCDGSCNQWFHQVCVGVSPEMAEKEDYICVRCTVKDAPSRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P29375	0.415	0.380	0.000	1690	0.528	0.483	P29375.pdb.gz	KDM5A_HUMAN Lysine-specific demethylase 5A OS=Homo sapiens OX=9606 GN=KDM5A PE=1 SV=3
2	AFDB:P41229	0.433	0.429	0.000	1560	0.461	0.456	P41229.pdb.gz	KDM5C_HUMAN Lysine-specific demethylase 5C OS=Homo sapiens OX=9606 GN=KDM5C PE=1 SV=2
3	AFDB:Q62240	0.411	0.410	0.000	1548	0.448	0.447	Q62240.pdb.gz	KDM5D_MOUSE Lysine-specific demethylase 5D OS=Mus musculus OX=10090 GN=Kdm5d PE=2 SV=2
4	AFDB:Q80Y84	0.444	0.444	0.000	1544	0.942	0.942	Q80Y84.pdb.gz	KDM5B_MOUSE Lysine-specific demethylase 5B OS=Mus musculus OX=10090 GN=Kdm5b PE=1 SV=1
5	AFDB:Q9BY66	0.436	0.438	0.000	1539	0.451	0.453	Q9BY66.pdb.gz	KDM5D_HUMAN Lysine-specific demethylase 5D OS=Homo sapiens OX=9606 GN=KDM5D PE=1 SV=2
6	AFDB:Q23541	0.375	0.391	2.493E-89	1477	0.277	0.289	Q23541.pdb.gz	KDM5_CAEEL Lysine-specific demethylase rbr-2 OS=Caenorhabditis elegans OX=6239 GN=rbr-2 PE=1 SV=2
7	AFDB:Q9US53	0.334	0.686	5.813E-48	715	0.139	0.301	Q9US53.pdb.gz	JMJ2_SCHPO Jumonji/ARID domain-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=jmj2 PE=4 SV=1
8	AFDB:Q9UT79	0.273	0.266	2.429E-46	1588	0.166	0.162	Q9UT79.pdb.gz	MSC1_SCHPO Multicopy suppressor of chk1 protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=msc1 PE=3 SV=1
9	AFDB:P47156	0.317	0.633	9.669E-41	728	0.130	0.275	P47156.pdb.gz	JHD2_YEAST Histone demethylase JHD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=JHD2 PE=1 SV=1
10	AFDB:F4I6G4	0.280	0.519	2.948E-40	819	0.137	0.259	F4I6G4.pdb.gz	JMJ18_ARATH Lysine-specific demethylase JMJ18 OS=Arabidopsis thaliana OX=3702 GN=JMJ18 PE=1 SV=1
11	PDB:3al5B	0.083	0.355	3.180E-3	311	0.017	0.087	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
12	PDB:3al5C	0.081	0.353	6.268E-3	284	0.018	0.099	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
13	PDB:4b7eA	0.094	0.347	1.574E-2	349	0.013	0.057	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
14	PDB:7r5jB0	0.042	0.038	2.435E-2	1748	0.065	0.057	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
15	PDB:7cl4F	0.051	0.232	3.257E-2	285	0.012	0.067	7cl4F.pdb.gz
16	PDB:5nfnB	0.090	0.350	3.419E-2	318	0.021	0.104	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.
17	PDB:4cclB	0.056	0.205	4.151E-2	372	0.012	0.048	4cclB.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
18	PDB:7yxgA	0.080	0.327	5.289E-2	313	0.014	0.067	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
19	PDB:4q5oA	0.054	0.248	5.552E-2	282	0.011	0.060	4q5oA.pdb.gz	Crystal structure of the ectoine hydroxylase, a snapshot of the active site.
20	PDB:5zmdG	0.070	0.212	6.117E-2	403	0.025	0.094	5zmdG.pdb.gz	Structural insights into FTO's catalytic mechanism for the demethylation of multiple RNA substrates.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A096MJZ8	1496	1635	0.472	0.445	A0A096MJZ8_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5a PE=1 SV=1
2	A0A0G2JTU9	1489	1553	0.472	0.469	A0A0G2JTU9_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5a PE=1 SV=2
3	A0A0G2JW30	718	630	0.223	0.546	A0A0G2JW30_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5c PE=3 SV=2
4	A0A0G2K1H0	1353	1554	0.464	0.461	A0A0G2K1H0_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5c PE=1 SV=1
5	A0A0G2K3N6	2976	1544	0.938	0.938	A0A0G2K3N6_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5b PE=3 SV=2
6	A0A0G2K454	1494	1634	0.472	0.446	A0A0G2K454_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5a PE=1 SV=1
7	A0A0G2K6G9	2887	1517	0.913	0.929	A0A0G2K6G9_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5b PE=3 SV=2
8	A0A0G2K897	1264	1510	0.442	0.452	A0A0G2K897_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5c PE=1 SV=2
9	A0A384MR42	1308	1539	0.432	0.433	A0A384MR42_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=SMCY PE=2 SV=1
10	A0A3B3IS40	3183	1539	0.997	1.000	A0A3B3IS40_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
11	A0A3B3ISE6	2998	1472	0.944	0.990	A0A3B3ISE6_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
12	A0A3B3IT25	3104	1517	0.972	0.989	A0A3B3IT25_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
13	A0A3B3IT85	658	316	0.204	0.997	A0A3B3IT85_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase (Fragment) OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
14	A0A3B3ITA8	3085	1499	0.971	1.000	A0A3B3ITA8_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
15	A0A3B3ITE7	3103	1505	0.971	0.996	A0A3B3ITE7_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
16	A0A3B3ITJ7	3095	1503	0.973	1.000	A0A3B3ITJ7_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
17	A0A8I5ZPK6	1493	1636	0.472	0.445	A0A8I5ZPK6_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5a PE=3 SV=1
18	A6N6J7	1351	1440	0.465	0.499	A6N6J7_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=JARID1C PE=2 SV=1
19	B0S6L0	1019	1578	0.361	0.353	B0S6L0_DANRE [histone H3]-trimethyl-L-lysine(4) demethylase OS=Danio rerio OX=7955 GN=im:7158173 PE=1 SV=1
20	B3KV94	2636	1275	0.826	1.000	B3KV94_HUMAN Jumonji, AT rich interactive domain 1B (RBP2-like), isoform CRA_a (Fragment) OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01388 ARID	2.7e-12	58.5	ARID/BRIGHT DNA binding domain
2	PF02373 JmjC	3.5e-41	151.6	JmjC domain, hydroxylase
3	PF02375 JmjN	5.4e-11	53.4	jmjN domain
4	PF00628 PHD	2.8e-21	86.5	PHD-finger
5	PF13831 PHD_2	0.021	25.6	PHD-finger
6	PF08429 PLU-1	3.3e-90	314.3	PLU-1-like protein
7	PF02928 zf-C5HC2	2.4e-11	55.1	C5HC2 zinc finger
8	PF15446 zf-PHD-like	5.2	18.1	PHD/FYVE-zinc-finger like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356234

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383042	0.991	Lysine-specific histone demethylase 1A
2	9606.ENSP00000355245	0.977	Paired box protein Pax-9
3	9606.ENSP00000479618	0.976	Myc proto-oncogene protein
4	9606.ENSP00000264606	0.963	Histone deacetylase 4
5	9606.ENSP00000331310	0.933	Mortality factor 4-like protein 1
6	9606.ENSP00000362649	0.927	Histone deacetylase 1
7	9606.ENSP00000384849	0.918	Cyclin-dependent kinase inhibitor 1
8	9606.ENSP00000201031	0.909	Transcription factor AP-2 gamma
9	9606.ENSP00000339004	0.904	Forkhead box protein G1
10	9606.ENSP00000367203	0.784	Lysine-specific demethylase 6A
11	9606.ENSP00000264515	0.774	Retinoblastoma-binding protein 5
12	9606.ENSP00000476960	0.763	Histone cluster 2 H3 pseudogene 2
13	9606.ENSP00000262241	0.762	REST corepressor 1
14	9606.ENSP00000262519	0.759	Histone-lysine N-methyltransferase SETD1A
15	9606.ENSP00000267163	0.758	Retinoblastoma-associated protein
16	9606.ENSP00000433205	0.754	BRCA2-interacting transcriptional repressor EMSY
17	9606.ENSP00000320147	0.748	Histone-lysine N-methyltransferase EZH2
18	9606.ENSP00000430432	0.747	Histone deacetylase 2
19	9606.ENSP00000380692	0.744	Lysine-specific demethylase 7A
20	9606.ENSP00000340896	0.741	Set1/Ash2 histone methyltransferase complex subunit ASH2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0032453	0.999	histone H3K4 demethylase activity
GO:0003676	0.942	nucleic acid binding
GO:0003677	0.911	DNA binding
GO:0008134	0.882	transcription factor binding
GO:0140297	0.841	DNA-binding transcription factor binding
GO:0043565	0.824	sequence-specific DNA binding
GO:0003690	0.798	double-stranded DNA binding
GO:1990837	0.778	sequence-specific double-stranded DNA binding
GO:0140110	0.730	transcription regulator activity
GO:0000976	0.659	transcription cis-regulatory region binding
GO:0008270	0.627	zinc ion binding
GO:0016706	0.613	2-oxoglutarate-dependent dioxygenase activity
GO:0003712	0.490	transcription coregulator activity
GO:0042393	0.429	histone binding
GO:0003682	0.322	chromatin binding
GO:0061629	0.313	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.975	biological regulation
GO:0050789	0.970	regulation of biological process
GO:0050794	0.962	regulation of cellular process
GO:0009987	0.907	cellular process
GO:0050896	0.897	response to stimulus
GO:0006355	0.871	regulation of DNA-templated transcription
GO:0042221	0.841	response to chemical
GO:1903507	0.799	negative regulation of nucleic acid-templated transcription
GO:0045892	0.776	negative regulation of DNA-templated transcription
GO:0048518	0.537	positive regulation of biological process
GO:0032502	0.499	developmental process
GO:0071704	0.474	organic substance metabolic process
GO:0044238	0.436	primary metabolic process
GO:0032501	0.409	multicellular organismal process
GO:0048856	0.391	anatomical structure development
GO:0006807	0.375	nitrogen compound metabolic process
GO:0009893	0.368	positive regulation of metabolic process
GO:0010604	0.353	positive regulation of macromolecule metabolic process
GO:0007275	0.344	multicellular organism development
GO:0043170	0.339	macromolecule metabolic process
GO:0048522	0.333	positive regulation of cellular process
GO:0006357	0.318	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0032991	0.541	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.11.-	0.613	With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.

[back to server]