StarFunc result for job id Q9UGM1

User Input

>input (479 residues)
MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTL
QITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLY
NKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNG
NQVDIFNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSSFY
IVNLLIPCVLISFLAPLSFYLPAASGEKVSLGVTILLAMTVFQLMVAEIMPASENVPLIG
KYYIATMALITASTALTIMVMNIHFCGAEARPVPHWARVVILKYMSRVLFVYDVGESCLS
PHHSRERDHLTKVYSKLPESNLKAARNKDLSRKKDMNKRLKNDLGCQGKNPQEAESYCAQ
YKVLTRNIEYIAKCLKDHKATNSKGSEWKKVAKVIDRFFMWIFFIMVFVMTILIIARAD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G3X8Z7	0.881	0.881	7.433E-79	479	0.910	0.910	G3X8Z7.pdb.gz	G3X8Z7_MOUSE Cholinergic receptor, nicotinic, alpha polypeptide 9 OS=Mus musculus OX=10090 GN=Chrna9 PE=3 SV=1
2	AFDB:Q9PTS8	0.872	0.863	1.509E-69	484	0.731	0.723	Q9PTS8.pdb.gz	ACHA9_CHICK Neuronal acetylcholine receptor subunit alpha-9 OS=Gallus gallus OX=9031 GN=CHRNA9 PE=1 SV=1
3	AFDB:Q9I8C7	0.817	0.865	2.212E-60	452	0.578	0.613	Q9I8C7.pdb.gz	ACH10_CHICK Neuronal acetylcholine receptor subunit alpha-10 OS=Gallus gallus OX=9031 GN=CHRNA10 PE=3 SV=1
4	AFDB:Q9GZZ6	0.830	0.883	2.800E-58	450	0.522	0.556	Q9GZZ6.pdb.gz	ACH10_HUMAN Neuronal acetylcholine receptor subunit alpha-10 OS=Homo sapiens OX=9606 GN=CHRNA10 PE=1 SV=1
5	AFDB:E1JJR2	0.825	0.705	9.978E-47	564	0.340	0.289	E1JJR2.pdb.gz	E1JJR2_DROME Nicotinic acetylcholine receptor alpha7, isoform E OS=Drosophila melanogaster OX=7227 GN=nAChRalpha7 PE=3 SV=1
6	AFDB:F1P4Y5	0.780	0.746	1.310E-46	502	0.355	0.339	F1P4Y5.pdb.gz
7	AFDB:P09481	0.772	0.747	1.460E-46	496	0.326	0.315	P09481.pdb.gz	ACHA3_CHICK Neuronal acetylcholine receptor subunit alpha-3 OS=Gallus gallus OX=9031 GN=CHRNA3 PE=1 SV=2
8	AFDB:P32297	0.778	0.739	2.382E-46	505	0.340	0.323	P32297.pdb.gz	ACHA3_HUMAN Neuronal acetylcholine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=CHRNA3 PE=1 SV=4
9	AFDB:Q03481	0.785	0.738	2.805E-46	511	0.365	0.342	Q03481.pdb.gz	Q03481_CHICK Alpha8 subunit of nicotinic acetylcholine receptor OS=Gallus gallus OX=9031 GN=CHRNA8 PE=2 SV=1
10	AFDB:Q9R0W9	0.801	0.777	5.387E-46	494	0.332	0.322	Q9R0W9.pdb.gz	ACHA6_MOUSE Neuronal acetylcholine receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Chrna6 PE=2 SV=2
11	PDB:6i53B	0.569	0.791	2.228E-22	338	0.152	0.216	6i53B.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
12	PDB:4aq5E	0.499	0.629	1.667E-21	370	0.271	0.351	4aq5E.pdb.gz
13	PDB:6i53A	0.547	0.739	8.525E-21	349	0.115	0.158	6i53A.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
14	PDB:2w8gC	0.400	0.857	1.079E-18	217	0.113	0.249	2w8gC.pdb.gz	Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
15	PDB:4hfcA	0.532	0.790	1.079E-18	311	0.111	0.170	4hfcA.pdb.gz	Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
16	PDB:7kuyE	0.526	0.721	7.649E-18	338	0.144	0.204	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
17	PDB:4afhA	0.400	0.870	7.513E-17	213	0.115	0.258	4afhA.pdb.gz	Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
18	PDB:7l6qA	0.476	0.713	4.207E-15	311	0.119	0.183	7l6qA.pdb.gz	Structure and function at the lipid-protein interface of a pentameric ligand-gated ion channel.
19	PDB:6zgdA	0.429	0.671	9.869E-11	288	0.106	0.177	6zgdA.pdb.gz
20	PDB:4wz9B	0.127	0.081	2.446E-3	887	0.044	0.024	4wz9B.pdb.gz	The Anopheles-midgut APN1 structure reveals a new malaria transmission-blocking vaccine epitope.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RX82	0.0	516	447	0.511	0.548	B2RX82_MOUSE Cholinergic receptor, nicotinic, alpha polypeptide 10 OS=Mus musculus OX=10090 GN=Chrna10 PE=2 SV=1
2	G3X8Z7	0.0	915	479	0.910	0.910	G3X8Z7_MOUSE Cholinergic receptor, nicotinic, alpha polypeptide 9 OS=Mus musculus OX=10090 GN=Chrna9 PE=3 SV=1
3	P43144	0.0	917	479	0.912	0.912	ACHA9_RAT Neuronal acetylcholine receptor subunit alpha-9 OS=Rattus norvegicus OX=10116 GN=Chrna9 PE=1 SV=2
4	Q9GZZ6	0.0	523	450	0.520	0.553	ACH10_HUMAN Neuronal acetylcholine receptor subunit alpha-10 OS=Homo sapiens OX=9606 GN=CHRNA10 PE=1 SV=1
5	Q9I8C7	0.0	587	452	0.582	0.617	ACH10_CHICK Neuronal acetylcholine receptor subunit alpha-10 OS=Gallus gallus OX=9031 GN=CHRNA10 PE=3 SV=1
6	Q9JLB5	0.0	518	447	0.514	0.550	ACH10_RAT Neuronal acetylcholine receptor subunit alpha-10 OS=Rattus norvegicus OX=10116 GN=Chrna10 PE=1 SV=1
7	Q9PTS8	0.0	753	484	0.737	0.729	ACHA9_CHICK Neuronal acetylcholine receptor subunit alpha-9 OS=Gallus gallus OX=9031 GN=CHRNA9 PE=1 SV=1
8	Q9UGM1	0.0	998	479	1.000	1.000	ACHA9_HUMAN Neuronal acetylcholine receptor subunit alpha-9 OS=Homo sapiens OX=9606 GN=CHRNA9 PE=1 SV=2
9	A0A0J9YUW0	6.72e-173	488	258	0.484	0.899	A0A0J9YUW0_MOUSE Cholinergic receptor, nicotinic, alpha polypeptide 9 (Fragment) OS=Mus musculus OX=10090 GN=Chrna9 PE=3 SV=3
10	Q8K3J4	7.09e-167	472	248	0.472	0.911	Q8K3J4_MOUSE Nicotinic acetylcholine receptor alpha 9 subunit (Fragment) OS=Mus musculus OX=10090 GN=Chrna9 PE=2 SV=1
11	Q15825	3.48e-110	337	494	0.336	0.326	ACHA6_HUMAN Neuronal acetylcholine receptor subunit alpha-6 OS=Homo sapiens OX=9606 GN=CHRNA6 PE=1 SV=1
12	P22770	2.01e-108	332	502	0.365	0.349	ACHA7_CHICK Neuronal acetylcholine receptor subunit alpha-7 OS=Gallus gallus OX=9031 GN=CHRNA7 PE=1 SV=1
13	P43143	4.11e-108	331	493	0.355	0.345	ACHA6_RAT Neuronal acetylcholine receptor subunit alpha-6 OS=Rattus norvegicus OX=10116 GN=Chrna6 PE=2 SV=1
14	Q9R0W9	7.50e-108	331	494	0.349	0.338	ACHA6_MOUSE Neuronal acetylcholine receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Chrna6 PE=2 SV=2
15	Q866A2	2.04e-107	330	502	0.376	0.359	ACHA7_MACMU Neuronal acetylcholine receptor subunit alpha-7 OS=Macaca mulatta OX=9544 GN=CHRNA7 PE=2 SV=1
16	Q800C7	2.95e-107	330	509	0.374	0.352	Q800C7_DANRE Neuronal acetylcholine receptor subunit alpha-7 OS=Danio rerio OX=7955 GN=chrna7 PE=2 SV=1
17	P36544	4.54e-107	329	502	0.376	0.359	ACHA7_HUMAN Neuronal acetylcholine receptor subunit alpha-7 OS=Homo sapiens OX=9606 GN=CHRNA7 PE=1 SV=5
18	M9PDC9	6.82e-107	328	499	0.376	0.361	M9PDC9_DROME Nicotinic acetylcholine receptor alpha4, isoform G OS=Drosophila melanogaster OX=7227 GN=nAChRalpha4 PE=3 SV=1
19	P49582	1.25e-105	325	502	0.363	0.347	ACHA7_MOUSE Neuronal acetylcholine receptor subunit alpha-7 OS=Mus musculus OX=10090 GN=Chrna7 PE=1 SV=1
20	Q05941	1.34e-105	325	502	0.363	0.347	ACHA7_RAT Neuronal acetylcholine receptor subunit alpha-7 OS=Rattus norvegicus OX=10116 GN=Chrna7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18910 DUF5665	2.7e+02	13.1	Domain of unknown function (DUF5665)
2	PF02931 Neur_chan_LBD	4.4e-64	227.4	Neurotransmitter-gated ion-channel ligand binding domain
3	PF02932 Neur_chan_memb	9e-47	171.7	Neurotransmitter-gated ion-channel transmembrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312663

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000407546	0.922	Neuronal acetylcholine receptor subunit alpha-7
2	9606.ENSP00000261751	0.911	Neuronal acetylcholine receptor subunit beta-4
3	9606.ENSP00000357461	0.911	Neuronal acetylcholine receptor subunit beta-2
4	9606.ENSP00000359285	0.910	Neuronal acetylcholine receptor subunit alpha-4
5	9606.ENSP00000385026	0.909	Neuronal acetylcholine receptor subunit alpha-2
6	9606.ENSP00000315602	0.908	Neuronal acetylcholine receptor subunit alpha-3
7	9606.ENSP00000304290	0.758	Acetylcholine receptor subunit beta
8	9606.ENSP00000337103	0.738	Choline O-acetyltransferase
9	9606.ENSP00000257189	0.721	Desmoglein-3
10	9606.ENSP00000246515	0.703	Secreted Ly-6/uPAR-related protein 1
11	9606.ENSP00000371212	0.678	RNA-binding protein 47
12	9606.ENSP00000261007	0.638	Acetylcholine receptor subunit alpha
13	9606.ENSP00000299847	0.632	CHRNA7-FAM7A fusion protein
14	9606.ENSP00000286298	0.623	Sulfate transporter
15	9606.ENSP00000374145	0.606	Acetylcholine receptor subunit gamma
16	9606.ENSP00000424711	0.603	Clarin-2
17	9606.ENSP00000258385	0.600	Acetylcholine receptor subunit delta
18	9606.ENSP00000293780	0.600	Acetylcholine receptor subunit epsilon
19	9606.ENSP00000299565	0.588	Neuronal acetylcholine receptor subunit alpha-5
20	9606.ENSP00000289957	0.585	Neuronal acetylcholine receptor subunit beta-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0022848	1.000	acetylcholine-gated monoatomic cation-selective channel activity
GO:0005515	0.996	protein binding
GO:0004888	0.982	transmembrane signaling receptor activity
GO:0015464	0.645	acetylcholine receptor activity
GO:0015318	0.447	inorganic molecular entity transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0042391	0.997	regulation of membrane potential
GO:0051899	0.991	membrane depolarization
GO:0050896	0.952	response to stimulus
GO:0050789	0.913	regulation of biological process
GO:0050794	0.837	regulation of cellular process
GO:0032501	0.768	multicellular organismal process
GO:0009987	0.697	cellular process
GO:0003008	0.660	system process
GO:0050877	0.496	nervous system process
GO:0006810	0.402	transport
GO:0023052	0.340	signaling
GO:0007154	0.340	cell communication
GO:0051716	0.325	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005892	0.999	acetylcholine-gated channel complex
GO:0043226	0.920	organelle
GO:0005622	0.651	intracellular anatomical structure
GO:0045202	0.362	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]