StarFunc result for job id Q9UGM3

User Input

>input (2413 residues)
MGISTVILEMCLLWGQVLSTGGWIPRTTDYASLIPSEVPLDPTVAEGSPFPSESTLESTV
AEGSPISLESTLESTVAEGSLIPSESTLESTVAEGSDSGLALRLVNGDGRCQGRVEILYR
GSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNAWFGQGSGPIALDDVRCSGHESYLWS
CPHNGWLSHNCGHGEDAGVICSAAQPQSTLRPESWPVRISPPVPTEGSESSLALRLVNGG
DRCRGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPGNAQFGQGSGPIVLDD
VRCSGHESYLWSCPHNGWLTHNCGHSEDAGVICSAPQSRPTPSPDTWPTSHASTAGPESS
LALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPGNARFGQ
GSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVICSAAHSWSTPSPDTLPTIT
LPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWA
MLAPGNARFGQGSGPIVLDDVRCSGNESYLWSCPHNGWLSHNCGHSEDAGVICSGPESSL
ALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSAPGNARFGQG
SGPIVLDDVRCSGHESYLWSCPNNGWLSHNCGHHEDAGVICSAAQSRSTPRPDTLSTITL
PPSTVGSESSLTLRLVNGSDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWAT
SAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSVSQSRPT
PSPDTWPTSHASTAGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTSDANVVC
RQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVI
CSAAHSWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYQGSWGTVCDD
SWDTNDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSH
NCGHSEDAGVICSASQSRPTPSPDTWPTSHASTAGSESSLALRLVNGGDRCQGRVEVLYR
GSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVRCSGHESYLWS
CPHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSHASTAGSESSLALRLVNGGDRC
QGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRC
SGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSHASTAGSESSLAL
RLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSG
PIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSRAST
AGSESTLALRLVNGGDRCRGRVEVLYQGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPG
NAQFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSAAQSQSTPRPD
TWLTTNLPALTVGSESSLALRLVNGGDRCRGRVEVLYRGSWGTVCDDSWDTNDANVVCRQ
LGCGWAMSAPGNARFGQGSGPIVLDDVRCSGNESYLWSCPHKGWLTHNCGHHEDAGVICS
ATQINSTTTDWWHPTTTTTARPSSNCGGFLFYASGTFSSPSYPAYYPNNAKCVWEIEVNS
GYRINLGFSNLKLEAHHNCSFDYVEIFDGSLNSSLLLGKICNDTRQIFTSSYNRMTIHFR
SDISFQNTGFLAWYNSFPSDATLRLVNLNSSYGLCAGRVEIYHGGTWGTVCDDSWTIQEA
EVVCRQLGCGRAVSALGNAYFGSGSGPITLDDVECSGTESTLWQCRNRGWFSHNCNHRED
AGVICSGNHLSTPAPFLNITRPNTDYSCGGFLSQPSGDFSSPFYPGNYPNNAKCVWDIEV
QNNYRVTVIFRDVQLEGGCNYDYIEVFDGPYRSSPLIARVCDGARGSFTSSSNFMSIRFI
SDHSITRRGFRAEYYSSPSNDSTNLLCLPNHMQASVSRSYLQSLGFSASDLVISTWNGYY
ECRPQITPNLVIFTIPYSGCGTFKQADNDTIDYSNFLTAAVSGGIIKRRTDLRIHVSCRM
LQNTWVDTMYIANDTIHVANNTIQVEEVQYGNFDVNISFYTSSSFLYPVTSRPYYVDLNQ
DLYVQAEILHSDAVLTLFVDTCVASPYSNDFTSLTYDLIRSGCVRDDTYGPYSSPSLRIA
RFRFRAFHFLNRFPSVYLRCKMVVCRAYDPSSRCYRGCVLRSKRDVGSYQEKVDVVLGPI
QLQTPPRREEEPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q60997	0.171	0.196	0.000	2085	0.478	0.553	Q60997.pdb.gz	DMBT1_MOUSE Deleted in malignant brain tumors 1 protein OS=Mus musculus OX=10090 GN=Dmbt1 PE=1 SV=2
2	AFDB:Q8CIZ5	0.115	0.176	0.000	1418	0.321	0.547	Q8CIZ5.pdb.gz	DMBT1_RAT Deleted in malignant brain tumors 1 protein OS=Rattus norvegicus OX=10116 GN=Dmbt1 PE=1 SV=1
3	AFDB:Q9UGM3	1.000	1.000	0.000	2413	1.000	1.000	Q9UGM3.pdb.gz	DMBT1_HUMAN Deleted in malignant brain tumors 1 protein OS=Homo sapiens OX=9606 GN=DMBT1 PE=1 SV=2
4	AFDB:Q86VB7	0.097	0.140	2.485E-97	1156	0.201	0.420	Q86VB7.pdb.gz	C163A_HUMAN Scavenger receptor cysteine-rich type 1 protein M130 OS=Homo sapiens OX=9606 GN=CD163 PE=1 SV=2
5	AFDB:A0A0G2JVY2	0.093	0.169	1.047E-95	1111	0.196	0.425	A0A0G2JVY2.pdb.gz	A0A0G2JVY2_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=1 SV=2
6	AFDB:A0A1B0GSB0	0.079	0.156	1.073E-76	991	0.160	0.388	A0A1B0GSB0.pdb.gz	A0A1B0GSB0_MOUSE Scavenger receptor family member expressed on T cells 1 OS=Mus musculus OX=10090 GN=Scart1 PE=1 SV=1
7	AFDB:B3F5L5	0.076	0.148	5.590E-73	996	0.154	0.373	B3F5L5.pdb.gz	B3F5L5_MOUSE SCART2 splice variant B OS=Mus musculus OX=10090 GN=Scart2 PE=1 SV=1
8	AFDB:Q4G0T1	0.082	0.147	3.856E-69	1027	0.159	0.373	Q4G0T1.pdb.gz	SRCRM_HUMAN Scavenger receptor cysteine-rich domain-containing protein SCART1 OS=Homo sapiens OX=9606 GN=SCART1 PE=1 SV=2
9	AFDB:A1L4H1	0.076	0.103	8.375E-63	1573	0.164	0.252	A1L4H1.pdb.gz	SRCRL_HUMAN Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D OS=Homo sapiens OX=9606 GN=SSC5D PE=1 SV=3
10	AFDB:Q86UP6	0.106	0.402	9.422E-44	607	0.078	0.310	Q86UP6.pdb.gz	CUZD1_HUMAN CUB and zona pellucida-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CUZD1 PE=2 SV=1
11	PDB:4wrnB	0.059	0.201	1.275E-13	663	0.027	0.097	4wrnB.pdb.gz	A structured interdomain linker directs self-polymerization of human uromodulin.
12	PDB:4wrnA	0.058	0.187	3.738E-13	693	0.028	0.097	4wrnA.pdb.gz	A structured interdomain linker directs self-polymerization of human uromodulin.
13	PDB:5hzvA	0.060	0.199	8.793E-10	598	0.017	0.070	5hzvA.pdb.gz	Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1.
14	PDB:7b01A	0.053	0.149	2.091E-7	588	0.020	0.082	7b01A.pdb.gz	Crystal structure of ADAMTS13 CUB domains reveals their role in global latency.
15	PDB:4n20A	0.041	0.114	1.602E-4	639	0.011	0.041	4n20A.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.
16	PDB:6l4cB	0.036	0.144	6.826E-4	373	0.012	0.078	6l4cB.pdb.gz	Comparative study of 7S globulin from Corylus avellana and Solanum lycopersicum revealed importance of salicylic acid and Cu-binding loop in modulating their function.
17	PDB:5hp5A	0.044	0.117	7.854E-4	669	0.016	0.057	5hp5A.pdb.gz	Monomeric Form of Peptidylarginine Deiminase Type I Revealed by X-ray Crystallography and Small-Angle X-ray Scattering
18	PDB:3am2A	0.038	0.262	8.230E-4	286	0.012	0.101	3am2A.pdb.gz
19	PDB:5a42A	0.042	0.055	1.040E-3	1597	0.029	0.044	5a42A.pdb.gz
20	PDB:2xrcC	0.039	0.186	1.314E-3	454	0.013	0.068	2xrcC.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JVY2	0.0	645	1151	0.157	0.328	A0A0G2JVY2_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=1 SV=2
2	A0A8I5ZQF0	0.0	644	1109	0.157	0.341	A0A8I5ZQF0_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=1 SV=1
3	D3Z9U2	0.0	643	1110	0.157	0.341	D3Z9U2_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=4 SV=2
4	Q60997	0.0	1127	2085	0.237	0.274	DMBT1_MOUSE Deleted in malignant brain tumors 1 protein OS=Mus musculus OX=10090 GN=Dmbt1 PE=1 SV=2
5	Q86VB7	0.0	716	1156	0.174	0.363	C163A_HUMAN Scavenger receptor cysteine-rich type 1 protein M130 OS=Homo sapiens OX=9606 GN=CD163 PE=1 SV=2
6	Q8CIZ5	0.0	654	1418	0.141	0.240	DMBT1_RAT Deleted in malignant brain tumors 1 protein OS=Rattus norvegicus OX=10116 GN=Dmbt1 PE=1 SV=1
7	Q9UGM3	0.0	4888	2413	1.000	1.000	DMBT1_HUMAN Deleted in malignant brain tumors 1 protein OS=Homo sapiens OX=9606 GN=DMBT1 PE=1 SV=2
8	Q8CGY7	3.70e-177	573	989	0.161	0.392	Q8CGY7_MOUSE Scavenger receptor cysteine-rich type 1 protein CD163c-alpha OS=Mus musculus OX=10090 GN=Scart1 PE=1 SV=1
9	A0A1B0GSB0	3.00e-176	570	991	0.161	0.393	A0A1B0GSB0_MOUSE Scavenger receptor family member expressed on T cells 1 OS=Mus musculus OX=10090 GN=Scart1 PE=1 SV=1
10	Q8BIC8	1.89e-173	562	991	0.160	0.391	Q8BIC8_MOUSE SRCR domain-containing protein OS=Mus musculus OX=10090 GN=Scart1 PE=2 SV=1
11	B3F5L5	2.15e-171	557	996	0.154	0.372	B3F5L5_MOUSE SCART2 splice variant B OS=Mus musculus OX=10090 GN=Scart2 PE=1 SV=1
12	B3F5L4	1.88e-166	547	1112	0.165	0.358	B3F5L4_MOUSE SCART2 splice variant A OS=Mus musculus OX=10090 GN=Scart2 PE=1 SV=1
13	Q4G0T1	2.34e-145	484	1027	0.155	0.365	SRCRM_HUMAN Scavenger receptor cysteine-rich domain-containing protein SCART1 OS=Homo sapiens OX=9606 GN=SCART1 PE=1 SV=2
14	A1L4H1	1.75e-130	453	1573	0.135	0.207	SRCRL_HUMAN Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D OS=Homo sapiens OX=9606 GN=SSC5D PE=1 SV=3
15	Q8BV57	3.59e-109	385	1371	0.103	0.181	SRCRL_MOUSE Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D OS=Mus musculus OX=10090 GN=Ssc5d PE=1 SV=1
16	P56730	5.22e-100	346	875	0.083	0.230	NETR_HUMAN Neurotrypsin OS=Homo sapiens OX=9606 GN=PRSS12 PE=2 SV=2
17	Q86UP6	9.58e-89	305	607	0.067	0.265	CUZD1_HUMAN CUB and zona pellucida-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CUZD1 PE=2 SV=1
18	Q9QZT0	2.90e-83	289	607	0.069	0.275	CUZD1_RAT CUB and zona pellucida-like domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Cuzd1 PE=2 SV=2
19	O08762	3.22e-80	285	761	0.064	0.202	NETR_MOUSE Neurotrypsin OS=Mus musculus OX=10090 GN=Prss12 PE=1 SV=1
20	P70412	4.70e-80	280	607	0.068	0.270	CUZD1_MOUSE CUB and zona pellucida-like domain-containing protein 1 OS=Mus musculus OX=10090 GN=Cuzd1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00431 CUB	6e-54	192.5	CUB domain
2	PF02408 CUB_2	0.84	20.8	CUB-like domain
3	PF00530 SRCR	0	1432.3	Scavenger receptor cysteine-rich domain
4	PF15494 SRCR_2	1.4e-47	171.7	Scavenger receptor cysteine-rich domain
5	PF00100 Zona_pellucida	1.1e-41	154.9	Zona pellucida-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357905

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361366	0.994	Pulmonary surfactant-associated protein D
2	9606.ENSP00000294338	0.960	PDZK1-interacting protein 1
3	9606.ENSP00000266041	0.909	Inter-alpha-trypsin inhibitor heavy chain H4
4	9606.ENSP00000254301	0.894	Galectin-3
5	9606.ENSP00000397082	0.826	Pulmonary surfactant-associated protein A1
6	9606.ENSP00000473091	0.812	Zinc finger protein 320
7	9606.ENSP00000436812	0.768	Mucin-5B
8	9606.ENSP00000291526	0.752	Trefoil factor 2
9	9606.ENSP00000475084	0.724	Dual oxidase 2
10	9606.ENSP00000263080	0.711	Aspartoacylase
11	9606.ENSP00000430690	0.703	Trefoil factor 3
12	9606.ENSP00000337513	0.693	Steroid receptor RNA activator 1
13	9606.ENSP00000407422	0.681	Mucin-7
14	9606.ENSP00000361400	0.673	Pulmonary surfactant-associated protein A2
15	9606.ENSP00000295213	0.628	Mitochondria-eating protein
16	9606.ENSP00000428331	0.600	Surfactant-associated protein 3
17	9606.ENSP00000243924	0.598	Elafin
18	9606.ENSP00000334644	0.541	Late cornified envelope protein 3C
19	9606.ENSP00000483403	0.537	Growth hormone receptor
20	9606.ENSP00000246895	0.508	Statherin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0038024	0.995	cargo receptor activity
GO:0005539	0.988	glycosaminoglycan binding
GO:0070891	0.979	lipoteichoic acid binding
GO:0038187	0.978	pattern recognition receptor activity
GO:0005044	0.977	scavenger receptor activity
GO:0001530	0.977	lipopolysaccharide binding
GO:0097159	0.916	organic cyclic compound binding
GO:1901681	0.909	sulfur compound binding
GO:0003676	0.909	nucleic acid binding
GO:0048306	0.908	calcium-dependent protein binding
GO:0043167	0.905	ion binding
GO:0036094	0.896	small molecule binding
GO:0031406	0.892	carboxylic acid binding
GO:0003677	0.858	DNA binding
GO:0042802	0.565	identical protein binding
GO:1904399	0.536	heparan sulfate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.991	response to stimulus
GO:0009987	0.981	cellular process
GO:0048856	0.931	anatomical structure development
GO:0042742	0.826	defense response to bacterium
GO:0065007	0.811	biological regulation
GO:0050789	0.778	regulation of biological process
GO:0050794	0.672	regulation of cellular process
GO:0050830	0.655	defense response to Gram-positive bacterium
GO:0030154	0.641	cell differentiation
GO:0030855	0.620	epithelial cell differentiation
GO:0050829	0.584	defense response to Gram-negative bacterium
GO:0032501	0.418	multicellular organismal process
GO:0048518	0.410	positive regulation of biological process
GO:0048522	0.381	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0031982	0.996	vesicle
GO:0005576	0.994	extracellular region
GO:0071944	0.993	cell periphery
GO:0012505	0.992	endomembrane system
GO:0031410	0.990	cytoplasmic vesicle
GO:0031090	0.978	organelle membrane
GO:0070062	0.952	extracellular exosome
GO:0012506	0.917	vesicle membrane
GO:0030659	0.904	cytoplasmic vesicle membrane
GO:0098588	0.895	bounding membrane of organelle
GO:0030139	0.712	endocytic vesicle
GO:0030141	0.651	secretory granule
GO:0005886	0.519	plasma membrane
GO:0043233	0.488	organelle lumen
GO:0030666	0.470	endocytic vesicle membrane
GO:0070013	0.436	intracellular organelle lumen
GO:0045335	0.436	phagocytic vesicle
GO:0030670	0.323	phagocytic vesicle membrane
GO:0031012	0.302	extracellular matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]