StarFunc result for job id Q9UGN4

User Input

>input (299 residues)
MWLPWALLLLWVPGCFALSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDK
IVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEV
EVSVFPASTSMTPASITAAKTSTITTAFPPVSSTTLFAVGATHSASIQEETEEVVNSQLP
LLLSLLALLLLLLVGASLLAWRMFQKWIKAGDHSELSQNPKQAATQSELHYANLELLMWP
LQEKPAPPREVEVEYSTVASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UGN4	1.000	1.000	3.291E-51	299	1.000	1.000	Q9UGN4.pdb.gz	CLM8_HUMAN CMRF35-like molecule 8 OS=Homo sapiens OX=9606 GN=CD300A PE=1 SV=2
2	AFDB:Q6SJQ0	0.359	0.339	2.791E-23	318	0.465	0.437	Q6SJQ0.pdb.gz	CLM8_MOUSE CMRF35-like molecule 8 OS=Mus musculus OX=10090 GN=Cd300a PE=1 SV=2
3	AFDB:Q6SJQ7	0.360	0.322	3.420E-19	337	0.355	0.315	Q6SJQ7.pdb.gz	CLM1_MOUSE CMRF35-like molecule 1 OS=Mus musculus OX=10090 GN=Cd300lf PE=1 SV=1
4	AFDB:Q496F6	0.366	0.525	5.465E-17	205	0.278	0.405	Q496F6.pdb.gz	CLM2_HUMAN CMRF35-like molecule 2 OS=Homo sapiens OX=9606 GN=CD300E PE=1 SV=2
5	AFDB:Q8VCH2	0.347	0.463	2.097E-16	221	0.234	0.317	Q8VCH2.pdb.gz	CLM5_MOUSE CMRF35-like molecule 5 OS=Mus musculus OX=10090 GN=Cd300ld PE=1 SV=1
6	AFDB:Q7TSN2	0.376	0.484	3.864E-16	228	0.268	0.351	Q7TSN2.pdb.gz	CLM4_MOUSE CMRF-35-like molecule 4 OS=Mus musculus OX=10090 GN=Cd300c2 PE=1 SV=2
7	AFDB:Q6SJQ5	0.361	0.437	8.047E-16	245	0.241	0.294	Q6SJQ5.pdb.gz	CLM3_MOUSE CMRF35-like molecule 3 OS=Mus musculus OX=10090 GN=Cd300ld3 PE=1 SV=1
8	AFDB:Q6UXZ3	0.356	0.530	1.483E-15	194	0.237	0.366	Q6UXZ3.pdb.gz	CLM5_HUMAN CMRF35-like molecule 5 OS=Homo sapiens OX=9606 GN=CD300LD PE=1 SV=1
9	AFDB:Q3LRV9	0.366	0.412	1.049E-14	263	0.224	0.255	Q3LRV9.pdb.gz	TRML4_MOUSE Trem-like transcript 4 protein OS=Mus musculus OX=10090 GN=Treml4 PE=1 SV=1
10	AFDB:Q1ERP8	0.351	0.320	1.115E-14	331	0.281	0.254	Q1ERP8.pdb.gz	CLM9_MOUSE CMRF35-like molecule 9 OS=Mus musculus OX=10090 GN=Cd300lg PE=1 SV=1
11	PDB:6xdsA	0.301	0.191	8.130E-10	485	0.114	0.070	6xdsA.pdb.gz	Development of a robust crystallization platform for immune receptor TREM2 using a crystallization chaperone strategy.
12	PDB:5ir3A	0.291	0.724	1.081E-7	111	0.057	0.153	5ir3A.pdb.gz
13	PDB:6jxrm	0.287	0.340	1.560E-7	248	0.057	0.069	6jxrm.pdb.gz
14	PDB:3oaiA	0.274	0.174	2.118E-7	488	0.080	0.049	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
15	PDB:6dldD	0.246	0.271	6.767E-7	269	0.067	0.074	6dldD.pdb.gz
16	PDB:6dlfA	0.255	0.317	6.767E-7	236	0.067	0.085	6dlfA.pdb.gz
17	PDB:2cd0A	0.267	0.646	9.765E-7	111	0.057	0.153	2cd0A.pdb.gz
18	PDB:5hhmI	0.276	0.404	1.038E-6	196	0.057	0.087	5hhmI.pdb.gz	Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
19	PDB:1cd0A	0.263	0.645	1.173E-6	111	0.054	0.144	1cd0A.pdb.gz
20	PDB:1bd2D	0.296	0.452	1.409E-6	190	0.037	0.058	1bd2D.pdb.gz	Two human T cell receptors bind in a similar diagonal mode to the HLA-A2/Tax peptide complex using different TCR amino acids.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UGN4	0.0	613	299	1.000	1.000	CLM8_HUMAN CMRF35-like molecule 8 OS=Homo sapiens OX=9606 GN=CD300A PE=1 SV=2
2	Q08708	3.27e-78	239	224	0.391	0.522	CLM6_HUMAN CMRF35-like molecule 6 OS=Homo sapiens OX=9606 GN=CD300C PE=1 SV=1
3	Q6SJQ0	1.80e-58	191	318	0.462	0.434	CLM8_MOUSE CMRF35-like molecule 8 OS=Mus musculus OX=10090 GN=Cd300a PE=1 SV=2
4	Q7TSN2	1.41e-34	127	228	0.261	0.342	CLM4_MOUSE CMRF-35-like molecule 4 OS=Mus musculus OX=10090 GN=Cd300c2 PE=1 SV=2
5	A0A0K2S4Q6	9.01e-34	124	201	0.247	0.368	CD3CH_HUMAN Protein CD300H OS=Homo sapiens OX=9606 GN=CD300H PE=1 SV=1
6	Q496F6	1.21e-27	108	205	0.207	0.302	CLM2_HUMAN CMRF35-like molecule 2 OS=Homo sapiens OX=9606 GN=CD300E PE=1 SV=2
7	Q8VCH2	6.85e-24	99.0	221	0.247	0.335	CLM5_MOUSE CMRF35-like molecule 5 OS=Mus musculus OX=10090 GN=Cd300ld PE=1 SV=1
8	Q3U497	2.83e-23	97.1	209	0.237	0.340	CLM7_MOUSE CMRF35-like molecule 7 OS=Mus musculus OX=10090 GN=Cd300lb PE=1 SV=2
9	A8K4G0	9.12e-22	92.8	201	0.227	0.338	CLM7_HUMAN CMRF35-like molecule 7 OS=Homo sapiens OX=9606 GN=CD300LB PE=1 SV=2
10	Q6SJQ7	2.39e-21	94.4	337	0.351	0.312	CLM1_MOUSE CMRF35-like molecule 1 OS=Mus musculus OX=10090 GN=Cd300lf PE=1 SV=1
11	Q1ERP8	8.48e-20	90.1	331	0.187	0.169	CLM9_MOUSE CMRF35-like molecule 9 OS=Mus musculus OX=10090 GN=Cd300lg PE=1 SV=1
12	Q6SJQ5	1.13e-19	88.2	245	0.184	0.224	CLM3_MOUSE CMRF35-like molecule 3 OS=Mus musculus OX=10090 GN=Cd300ld3 PE=1 SV=1
13	Q8TDQ1	1.83e-18	85.5	290	0.321	0.331	CLM1_HUMAN CMRF35-like molecule 1 OS=Homo sapiens OX=9606 GN=CD300LF PE=1 SV=3
14	Q6UXZ3	1.11e-17	81.3	194	0.164	0.253	CLM5_HUMAN CMRF35-like molecule 5 OS=Homo sapiens OX=9606 GN=CD300LD PE=1 SV=1
15	Q6UXG3	1.60e-15	77.8	332	0.151	0.136	CLM9_HUMAN CMRF35-like molecule 9 OS=Homo sapiens OX=9606 GN=CD300LG PE=1 SV=2
16	P01833	2.77e-12	69.3	764	0.151	0.059	PIGR_HUMAN Polymeric immunoglobulin receptor OS=Homo sapiens OX=9606 GN=PIGR PE=1 SV=4
17	P15083	6.36e-11	65.1	769	0.140	0.055	PIGR_RAT Polymeric immunoglobulin receptor OS=Rattus norvegicus OX=10116 GN=Pigr PE=1 SV=1
18	Q3LRV9	9.37e-11	63.2	263	0.161	0.183	TRML4_MOUSE Trem-like transcript 4 protein OS=Mus musculus OX=10090 GN=Treml4 PE=1 SV=1
19	O95944	4.35e-10	61.6	276	0.258	0.279	NCTR2_HUMAN Natural cytotoxicity triggering receptor 2 OS=Homo sapiens OX=9606 GN=NCR2 PE=1 SV=2
20	Q8WWV6	5.69e-10	62.0	532	0.157	0.088	FCAMR_HUMAN High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor OS=Homo sapiens OX=9606 GN=FCAMR PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00047 ig	0.12	23.8	Immunoglobulin domain
2	PF13927 Ig_3	42	16.1	Immunoglobulin domain
3	PF05083 LST1	11	17.7	LST-1 protein
4	PF15050 SCIMP	14	17.5	SCIMP protein
5	PF15330 SIT	1.1e-09	50.2	SHP2-interacting transmembrane adaptor protein, SIT
6	PF15102 TMEM154	7.8	17.8	TMEM154 protein family
7	PF07686 V-set	2.8e-10	51.7	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353259

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000441600	0.762	C-C chemokine receptor type 3
2	9606.ENSP00000312134	0.751	Bone marrow proteoglycan
3	9606.ENSP00000262629	0.738	TYRO protein tyrosine kinase-binding protein
4	9606.ENSP00000303276	0.737	Non-secretory ribonuclease
5	9606.ENSP00000244709	0.721	Triggering receptor expressed on myeloid cells 1
6	9606.ENSP00000227163	0.706	Transcription factor PU.1
7	9606.ENSP00000362205	0.694	Triggering receptor expressed on myeloid cells 2
8	9606.ENSP00000340944	0.661	Tyrosine-protein phosphatase non-receptor type 11
9	9606.ENSP00000363089	0.661	Toll-like receptor 4
10	9606.ENSP00000323328	0.646	Sialic acid-binding Ig-like lectin 7
11	9606.ENSP00000315997	0.641	Leukocyte immunoglobulin-like receptor subfamily B member 1
12	9606.ENSP00000350467	0.641	GCN5 related N-acetyltransferases
13	9606.ENSP00000375622	0.635	Leukocyte-associated immunoglobulin-like receptor 1
14	9606.ENSP00000376397	0.635	CMRF35-like molecule 7
15	9606.ENSP00000402855	0.634	Trem-like transcript 1 protein
16	9606.ENSP00000462309	0.622	CMRF35-like molecule 1
17	9606.ENSP00000480132	0.620	Neural cell adhesion molecule 1
18	9606.ENSP00000289902	0.609	High affinity immunoglobulin epsilon receptor subunit gamma
19	9606.ENSP00000296140	0.600	C-C chemokine receptor type 1
20	9606.ENSP00000364210	0.598	Advanced glycosylation end product-specific receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0005515	1.000	protein binding
GO:0001786	0.997	phosphatidylserine binding
GO:0008429	0.630	phosphatidylethanolamine binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0048583	0.981	regulation of response to stimulus
GO:0002682	0.976	regulation of immune system process
GO:0048522	0.976	positive regulation of cellular process
GO:0009966	0.969	regulation of signal transduction
GO:0050776	0.963	regulation of immune response
GO:0031323	0.957	regulation of cellular metabolic process
GO:0080090	0.953	regulation of primary metabolic process
GO:0009987	0.952	cellular process
GO:0051249	0.952	regulation of lymphocyte activation
GO:0051171	0.940	regulation of nitrogen compound metabolic process
GO:0050896	0.939	response to stimulus
GO:0010604	0.928	positive regulation of macromolecule metabolic process
GO:0002684	0.924	positive regulation of immune system process
GO:0033003	0.924	regulation of mast cell activation
GO:0065009	0.913	regulation of molecular function
GO:0002703	0.913	regulation of leukocyte mediated immunity
GO:0048519	0.891	negative regulation of biological process
GO:0051246	0.889	regulation of protein metabolic process
GO:0051174	0.888	regulation of phosphorus metabolic process
GO:0051241	0.884	negative regulation of multicellular organismal process
GO:0031347	0.881	regulation of defense response
GO:0045088	0.872	regulation of innate immune response
GO:0023052	0.869	signaling
GO:0051250	0.859	negative regulation of lymphocyte activation
GO:0023057	0.852	negative regulation of signaling
GO:0030155	0.839	regulation of cell adhesion
GO:0050790	0.831	regulation of catalytic activity
GO:0022407	0.820	regulation of cell-cell adhesion
GO:0070663	0.813	regulation of leukocyte proliferation
GO:0007154	0.809	cell communication
GO:1903037	0.805	regulation of leukocyte cell-cell adhesion
GO:0051716	0.794	cellular response to stimulus
GO:0019220	0.789	regulation of phosphate metabolic process
GO:0009892	0.786	negative regulation of metabolic process
GO:0010605	0.783	negative regulation of macromolecule metabolic process
GO:0032944	0.767	regulation of mononuclear cell proliferation
GO:0010648	0.763	negative regulation of cell communication
GO:0002704	0.761	negative regulation of leukocyte mediated immunity
GO:0050777	0.756	negative regulation of immune response
GO:0070664	0.754	negative regulation of leukocyte proliferation
GO:0002699	0.753	positive regulation of immune effector process
GO:1903038	0.751	negative regulation of leukocyte cell-cell adhesion
GO:0002376	0.747	immune system process
GO:0050670	0.731	regulation of lymphocyte proliferation
GO:0050863	0.730	regulation of T cell activation
GO:0042325	0.725	regulation of phosphorylation
GO:1903305	0.721	regulation of regulated secretory pathway
GO:0009968	0.721	negative regulation of signal transduction
GO:0001932	0.721	regulation of protein phosphorylation
GO:0043300	0.713	regulation of leukocyte degranulation
GO:0007165	0.707	signal transduction
GO:0045936	0.706	negative regulation of phosphate metabolic process
GO:0050868	0.706	negative regulation of T cell activation
GO:0032945	0.704	negative regulation of mononuclear cell proliferation
GO:0051128	0.689	regulation of cellular component organization
GO:0002886	0.678	regulation of myeloid leukocyte mediated immunity
GO:0031400	0.678	negative regulation of protein modification process
GO:0045920	0.676	negative regulation of exocytosis
GO:0001933	0.648	negative regulation of protein phosphorylation
GO:0035303	0.647	regulation of dephosphorylation
GO:0044092	0.636	negative regulation of molecular function
GO:0043304	0.634	regulation of mast cell degranulation
GO:0043086	0.625	negative regulation of catalytic activity
GO:0030100	0.621	regulation of endocytosis
GO:0045806	0.614	negative regulation of endocytosis
GO:1902531	0.612	regulation of intracellular signal transduction
GO:0050730	0.607	regulation of peptidyl-tyrosine phosphorylation
GO:0043549	0.590	regulation of kinase activity
GO:0031325	0.573	positive regulation of cellular metabolic process
GO:0050764	0.546	regulation of phagocytosis
GO:0006950	0.539	response to stress
GO:0045937	0.526	positive regulation of phosphate metabolic process
GO:0035304	0.496	regulation of protein dephosphorylation
GO:0050732	0.468	negative regulation of peptidyl-tyrosine phosphorylation
GO:0035306	0.461	positive regulation of dephosphorylation
GO:0006955	0.460	immune response
GO:0006952	0.451	defense response
GO:0032501	0.436	multicellular organismal process
GO:0044093	0.393	positive regulation of molecular function
GO:0048584	0.393	positive regulation of response to stimulus
GO:0062207	0.387	regulation of pattern recognition receptor signaling pathway
GO:0050672	0.387	negative regulation of lymphocyte proliferation
GO:0043408	0.381	regulation of MAPK cascade
GO:0050854	0.379	regulation of antigen receptor-mediated signaling pathway
GO:0030334	0.378	regulation of cell migration
GO:0051173	0.375	positive regulation of nitrogen compound metabolic process
GO:0010921	0.364	regulation of phosphatase activity
GO:0031401	0.350	positive regulation of protein modification process
GO:0050765	0.343	negative regulation of phagocytosis
GO:0010468	0.338	regulation of gene expression
GO:0010922	0.326	positive regulation of phosphatase activity
GO:0043666	0.324	regulation of phosphoprotein phosphatase activity
GO:0043409	0.318	negative regulation of MAPK cascade
GO:0007166	0.313	cell surface receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.998	membrane-bounded organelle
GO:0012505	0.993	endomembrane system
GO:0005737	0.990	cytoplasm
GO:0043231	0.986	intracellular membrane-bounded organelle
GO:0031982	0.971	vesicle
GO:0005576	0.961	extracellular region
GO:0031090	0.887	organelle membrane
GO:0005615	0.863	extracellular space
GO:0031410	0.861	cytoplasmic vesicle
GO:0043230	0.848	extracellular organelle
GO:0070062	0.836	extracellular exosome
GO:0098588	0.815	bounding membrane of organelle
GO:0030659	0.811	cytoplasmic vesicle membrane
GO:0070820	0.745	tertiary granule
GO:0030667	0.713	secretory granule membrane
GO:0070821	0.676	tertiary granule membrane
GO:0101002	0.475	ficolin-1-rich granule
GO:0101003	0.445	ficolin-1-rich granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]