StarFunc result for job id Q9UGP4

User Input

>input (676 residues)
MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFATKMAKIHLQQQ
QQQLLQEETLPRGSRGPVNGGGRLGPQARWEVVGSKLTVDGAAKPPLAASTGAPGAVTTL
AAGQPPYPPQEQRSRPYLHGTRHGSQDCGSRESLATSEMSAFHQPGPCEDPSCLTHGDYY
DNLSLASPKWGDKPGVSPSIGLSVGSGWPSSPGSDPPLPKPCGDHPLNHRQLSLSSSRSS
EGSLGGQNSGIGGRSSEKPTGLWSTASSQRVSPGLPSPNLENGAPAVGPVQPRTPSVSAP
LALSCPRQGGLPRSNSGLGGEVSGVMSKPNVDPQPWFQDGPKSYLSSSAPSSSPAGLDGS
QQGAVPGLGPKPGCTDLGTGPKLSPTSLVHPVMSTLPELSCKEGPLGWSSDGSLGSVLLD
SPSSPRVRLPCQPLVPGPELRPSAAELKLEALTQRLEREMDAHPKADYFGACVKCSKGVF
GAGQACQAMGNLYHDTCFTCAACSRKLRGKAFYFVNGKVFCEEDFLYSGFQQSADRCFLC
GHLIMDMILQALGKSYHPGCFRCVICNECLDGVPFTVDSENKIYCVRDYHKVLAPKCAAC
GLPILPPEGSDETIRVVSMDRDYHVECYHCEDCGLELNDEDGHRCYPLEDHLFCHSCHVK
RLEKRPSSTALHQHHF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UGP4	0.999	0.999	1.276E-100	676	1.000	1.000	Q9UGP4.pdb.gz	LIMD1_HUMAN LIM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMD1 PE=1 SV=1
2	AFDB:Q9QXD8	0.421	0.425	3.541E-75	668	0.774	0.783	Q9QXD8.pdb.gz	LIMD1_MOUSE LIM domain-containing protein 1 OS=Mus musculus OX=10090 GN=Limd1 PE=1 SV=2
3	AFDB:A9LS46	0.310	0.304	3.041E-39	690	0.401	0.393	A9LS46.pdb.gz	WTIP_XENLA Wilms tumor protein 1-interacting protein homolog OS=Xenopus laevis OX=8355 GN=wtip PE=1 SV=1
4	AFDB:Q8BFW7	0.223	0.243	1.274E-25	613	0.251	0.277	Q8BFW7.pdb.gz	LPP_MOUSE Lipoma-preferred partner homolog OS=Mus musculus OX=10090 GN=Lpp PE=1 SV=1
5	AFDB:A5H447	0.215	0.219	1.559E-23	663	0.228	0.232	A5H447.pdb.gz	ZYX_XENLA Zyxin OS=Xenopus laevis OX=8355 GN=zyx PE=1 SV=1
6	PDB:4kfzB	0.103	0.386	4.554E-7	148	0.047	0.216	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
7	PDB:1b8tA	0.100	0.323	7.525E-5	192	0.058	0.203	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
8	PDB:1imlA	0.074	0.567	6.421E-3	76	0.021	0.184	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
9	AFDB:B3DGT8	0.153	0.132	1.584E-2	793	0.080	0.068	B3DGT8.pdb.gz
10	AFDB:B7Z143	0.056	0.058	7.557E-2	630	0.167	0.179	B7Z143.pdb.gz	B7Z143_DROME Protein interacting with Ttk69 and Sin3A, isoform D OS=Drosophila melanogaster OX=7227 GN=Pits PE=3 SV=1
11	AFDB:O88491	0.058	0.024	1.222E-1	2588	0.155	0.041	O88491.pdb.gz	NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Mus musculus OX=10090 GN=Nsd1 PE=1 SV=1
12	AFDB:O94720	0.058	0.065	4.064E-1	557	0.127	0.154	O94720.pdb.gz	FIL1_SCHPO Transcription factor fil1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fil1 PE=2 SV=1
13	AFDB:Q96KQ4	0.067	0.047	4.583E-1	1090	0.132	0.082	Q96KQ4.pdb.gz	ASPP1_HUMAN Apoptosis-stimulating of p53 protein 1 OS=Homo sapiens OX=9606 GN=PPP1R13B PE=1 SV=3
14	PDB:7uhyC	0.072	0.082	9.992E-1	578	0.025	0.029	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
15	PDB:7kydA	0.035	0.042	1.197	534	0.010	0.013	7kydA.pdb.gz	FruitFire: a luciferase based on a fruit fly metabolic enzyme.
16	PDB:7pfo4	0.035	0.038	1.197	619	0.010	0.011	7pfo4.pdb.gz	Structure of a human replisome shows the organisation and interactions of a DNA replication machine.
17	PDB:7oniR	0.048	0.293	1.822	86	0.022	0.174	7oniR.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
18	PDB:5a31B	0.050	0.250	2.055	84	0.019	0.155	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
19	PDB:3tsyA	0.035	0.030	2.182	828	0.007	0.006	3tsyA.pdb.gz
20	PDB:7b5lH	0.050	0.076	2.461	423	0.015	0.024	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9JRJ5	0.0	1229	620	0.899	0.981	C9JRJ5_HUMAN LIM domain containing 1 OS=Homo sapiens OX=9606 GN=LIMD1 PE=1 SV=1
2	Q9QXD8	0.0	984	668	0.771	0.780	LIMD1_MOUSE LIM domain-containing protein 1 OS=Mus musculus OX=10090 GN=Limd1 PE=1 SV=2
3	Q9UGP4	0.0	1376	676	1.000	1.000	LIMD1_HUMAN LIM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMD1 PE=1 SV=1
4	Q06BR1	9.37e-142	429	612	0.294	0.325	LIMD1_XENLA LIM domain-containing protein 1 OS=Xenopus laevis OX=8355 GN=limd1 PE=1 SV=1
5	A9LS46	1.59e-123	384	690	0.263	0.258	WTIP_XENLA Wilms tumor protein 1-interacting protein homolog OS=Xenopus laevis OX=8355 GN=wtip PE=1 SV=1
6	Q7TQJ8	4.39e-119	363	398	0.244	0.415	WTIP_MOUSE Wilms tumor protein 1-interacting protein OS=Mus musculus OX=10090 GN=Wtip PE=1 SV=1
7	A8DZE6	1.08e-118	370	648	0.257	0.269	WTIP_DANRE Wilms tumor protein 1-interacting protein homolog OS=Danio rerio OX=7955 GN=wtip PE=3 SV=1
8	A6NIX2	3.07e-118	362	430	0.240	0.377	WTIP_HUMAN Wilms tumor protein 1-interacting protein OS=Homo sapiens OX=9606 GN=WTIP PE=1 SV=3
9	Q9VY77	9.94e-103	331	728	0.216	0.201	AJUBA_DROME LIM domain-containing protein jub OS=Drosophila melanogaster OX=7227 GN=jub PE=1 SV=3
10	Q91XC0	1.66e-99	317	547	0.204	0.252	AJUBA_MOUSE LIM domain-containing protein ajuba OS=Mus musculus OX=10090 GN=Ajuba PE=1 SV=1
11	Q5U2Z2	8.28e-99	315	548	0.201	0.248	AJUBA_RAT LIM domain-containing protein ajuba OS=Rattus norvegicus OX=10116 GN=Ajuba PE=1 SV=1
12	Q96IF1	1.59e-98	314	538	0.200	0.251	AJUBA_HUMAN LIM domain-containing protein ajuba OS=Homo sapiens OX=9606 GN=AJUBA PE=1 SV=1
13	E7FFI0	7.05e-93	304	688	0.185	0.182	E7FFI0_DANRE Ajuba LIM protein OS=Danio rerio OX=7955 GN=ajuba PE=4 SV=1
14	Q7ZU85	4.80e-70	240	556	0.146	0.178	Q7ZU85_DANRE LIM domain containing preferred translocation partner in lipoma OS=Danio rerio OX=7955 GN=zgc:56152 PE=1 SV=1
15	A0A087WZF1	8.44e-69	237	590	0.149	0.171	A0A087WZF1_HUMAN LIM domain containing preferred translocation partner in lipoma OS=Homo sapiens OX=9606 GN=LPP PE=1 SV=1
16	Q93052	9.19e-69	238	612	0.149	0.165	LPP_HUMAN Lipoma-preferred partner OS=Homo sapiens OX=9606 GN=LPP PE=1 SV=1
17	Q8BFW7	2.09e-68	237	613	0.151	0.166	LPP_MOUSE Lipoma-preferred partner homolog OS=Mus musculus OX=10090 GN=Lpp PE=1 SV=1
18	Q8T0F5	5.91e-64	223	564	0.145	0.174	Q8T0F5_DROME LD06023 isoform OS=Drosophila melanogaster OX=7227 GN=Zyx PE=2 SV=1
19	Q9N675	7.53e-64	224	585	0.145	0.168	Q9N675_DROME Zyx102 protein OS=Drosophila melanogaster OX=7227 GN=Zyx PE=1 SV=1
20	Q8I0G8	7.60e-64	222	523	0.145	0.187	Q8I0G8_DROME FI16750p1 OS=Drosophila melanogaster OX=7227 GN=Zyx PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00412 LIM	7.5e-27	104.6	LIM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000273317

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355601	0.988	Egl nine homolog 1
2	9606.ENSP00000437550	0.987	Serine/threonine-protein kinase LATS1
3	9606.ENSP00000379144	0.976	Trinucleotide repeat-containing gene 6A protein
4	9606.ENSP00000372035	0.966	Serine/threonine-protein kinase LATS2
5	9606.ENSP00000478754	0.945	Probable ATP-dependent RNA helicase DDX6
6	9606.ENSP00000362300	0.933	Protein argonaute-1
7	9606.ENSP00000220592	0.931	Protein argonaute-2
8	9606.ENSP00000408576	0.927	Probable leucine--tRNA ligase, mitochondrial
9	9606.ENSP00000433623	0.919	TNF receptor-associated factor 6
10	9606.ENSP00000266987	0.909	RISC-loading complex subunit TARBP2
11	9606.ENSP00000425561	0.907	Eukaryotic translation initiation factor 4E
12	9606.ENSP00000373715	0.906	m7GpppN-mRNA hydrolase
13	9606.ENSP00000437256	0.905	Endoribonuclease Dicer
14	9606.ENSP00000356520	0.902	ATP-dependent RNA helicase A
15	9606.ENSP00000265351	0.900	Exportin-5
16	9606.ENSP00000349722	0.900	Ubiquitin conjugating enzyme E2 D3
17	9606.ENSP00000363019	0.900	Ubiquitin-conjugating enzyme E2 D1
18	9606.ENSP00000381717	0.900	Ubiquitin-conjugating enzyme E2 D2
19	9606.ENSP00000324729	0.898	Protein salvador homolog 1
20	9606.ENSP00000355133	0.843	Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050789	0.990	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0048519	0.977	negative regulation of biological process
GO:0048523	0.905	negative regulation of cellular process
GO:0060255	0.871	regulation of macromolecule metabolic process
GO:0048583	0.870	regulation of response to stimulus
GO:0009966	0.819	regulation of signal transduction
GO:0008152	0.783	metabolic process
GO:0080090	0.781	regulation of primary metabolic process
GO:0051171	0.770	regulation of nitrogen compound metabolic process
GO:0010468	0.712	regulation of gene expression
GO:0010605	0.712	negative regulation of macromolecule metabolic process
GO:0050896	0.705	response to stimulus
GO:0031323	0.702	regulation of cellular metabolic process
GO:0071840	0.700	cellular component organization or biogenesis
GO:0016043	0.672	cellular component organization
GO:0048518	0.627	positive regulation of biological process
GO:0010556	0.620	regulation of macromolecule biosynthetic process
GO:0031326	0.617	regulation of cellular biosynthetic process
GO:0044237	0.584	cellular metabolic process
GO:0016441	0.561	post-transcriptional gene silencing
GO:0031047	0.560	RNA-mediated gene silencing
GO:0051172	0.559	negative regulation of nitrogen compound metabolic process
GO:0031324	0.553	negative regulation of cellular metabolic process
GO:0071704	0.516	organic substance metabolic process
GO:0044238	0.494	primary metabolic process
GO:0009968	0.445	negative regulation of signal transduction
GO:0051252	0.434	regulation of RNA metabolic process
GO:0006807	0.432	nitrogen compound metabolic process
GO:0010558	0.370	negative regulation of macromolecule biosynthetic process
GO:0031327	0.368	negative regulation of cellular biosynthetic process
GO:0043170	0.342	macromolecule metabolic process
GO:0035195	0.339	miRNA-mediated gene silencing
GO:0048856	0.307	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0005737	0.992	cytoplasm
GO:0016020	0.985	membrane
GO:0005886	0.960	plasma membrane
GO:0005829	0.957	cytosol
GO:0030054	0.911	cell junction
GO:0070161	0.865	anchoring junction
GO:0043232	0.859	intracellular non-membrane-bounded organelle
GO:0032991	0.770	protein-containing complex
GO:0016442	0.571	RISC complex
GO:0036464	0.557	cytoplasmic ribonucleoprotein granule
GO:0030055	0.510	cell-substrate junction
GO:0005925	0.473	focal adhesion
GO:0012505	0.339	endomembrane system
GO:0005912	0.329	adherens junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]