StarFunc result for job id Q9UGP5

User Input

>input (575 residues)
MDPRGILKAFPKRQKIHADASSKVLAKIPRREEGEEAEEWLSSLRAHVVRTGIGRARAEL
FEKQIVQHGGQLCPAQGPGVTHIVVDEGMDYERALRLLRLPQLPPGAQLVKSAWLSLCLQ
ERRLVDVAGFSIFIPSRYLDHPQPSKAEQDASIPPGTHEALLQTALSPPPPPTRPVSPPQ
KAKEAPNTQAQPISDDEASDGEETQVSAADLEALISGHYPTSLEGDCEPSPAPAVLDKWV
CAQPSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEAC
SIPGIGKRMAEKIIEILESGHLRKLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSL
EDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKAAQAFNSGLLCVACGSYRR
GKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRLP
GPGRRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNT
HGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UGP5	1.000	1.000	0.000	575	1.000	1.000	Q9UGP5.pdb.gz	DPOLL_HUMAN DNA polymerase lambda OS=Homo sapiens OX=9606 GN=POLL PE=1 SV=1
2	AFDB:Q9QXE2	0.759	0.762	3.778E-89	573	0.823	0.825	Q9QXE2.pdb.gz	DPOLL_MOUSE DNA polymerase lambda OS=Mus musculus OX=10090 GN=Poll PE=2 SV=1
3	AFDB:Q9FNY4	0.544	0.589	7.267E-41	529	0.294	0.319	Q9FNY4.pdb.gz	DPOLL_ARATH DNA polymerase lambda OS=Arabidopsis thaliana OX=3702 GN=POLL PE=1 SV=1
4	AFDB:Q67VC8	0.520	0.543	1.561E-40	549	0.290	0.304	Q67VC8.pdb.gz	DPOLL_ORYSJ DNA polymerase lambda OS=Oryza sativa subsp. japonica OX=39947 GN=POLL PE=1 SV=1
5	AFDB:Q9NP87	0.519	0.600	3.947E-33	494	0.247	0.287	Q9NP87.pdb.gz	DPOLM_HUMAN DNA-directed DNA/RNA polymerase mu OS=Homo sapiens OX=9606 GN=POLM PE=1 SV=1
6	AFDB:E9PT58	0.522	0.585	1.547E-32	510	0.240	0.271	E9PT58.pdb.gz	E9PT58_RAT DNA nucleotidylexotransferase OS=Rattus norvegicus OX=10116 GN=Dntt PE=3 SV=1
7	AFDB:Q9JIW4	0.522	0.600	2.267E-32	496	0.235	0.272	Q9JIW4.pdb.gz	DPOLM_MOUSE DNA-directed DNA/RNA polymerase mu OS=Mus musculus OX=10090 GN=Polm PE=1 SV=2
8	AFDB:P04053	0.513	0.577	7.142E-32	509	0.224	0.253	P04053.pdb.gz	TDT_HUMAN DNA nucleotidylexotransferase OS=Homo sapiens OX=9606 GN=DNTT PE=1 SV=3
9	AFDB:Q09693	0.504	0.567	1.223E-30	506	0.237	0.269	Q09693.pdb.gz	DPO4_SCHPO DNA polymerase type-X family protein pol4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pol4 PE=3 SV=1
10	AFDB:P06746	0.500	0.830	1.864E-28	335	0.197	0.337	P06746.pdb.gz	DPOLB_HUMAN DNA polymerase beta OS=Homo sapiens OX=9606 GN=POLB PE=1 SV=3
11	PDB:4rq2A	0.507	0.856	1.179E-27	333	0.193	0.333	4rq2A.pdb.gz	Viewing Human DNA Polymerase beta Faithfully and Unfaithfully Bypass an Oxidative Lesion by Time-Dependent Crystallography.
12	PDB:7co6A	0.525	0.887	2.514E-26	332	0.190	0.328	7co6A.pdb.gz	Mechanism of genome instability mediated by human DNA polymerase mu misincorporation.
13	PDB:5hrfA	0.234	0.702	5.466E-7	178	0.075	0.242	5hrfA.pdb.gz	The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
14	PDB:4e7xD	0.142	0.239	4.784E-4	320	0.047	0.084	4e7xD.pdb.gz
15	PDB:4ud5B	0.176	0.284	5.053E-4	342	0.037	0.061	4ud5B.pdb.gz
16	PDB:7lsyY	0.140	0.096	6.957E-3	855	0.021	0.014	7lsyY.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.
17	PDB:3c66A	0.122	0.132	1.269E-2	529	0.045	0.049	3c66A.pdb.gz	Structure of yeast poly(A) polymerase in complex with a peptide from Fip1, an intrinsically disordered protein.
18	PDB:2q0eA	0.154	0.245	1.340E-2	331	0.052	0.091	2q0eA.pdb.gz	Dual role of the RNA substrate in selectivity and catalysis by terminal uridylyl transferases.
19	PDB:3hj1B	0.146	0.207	1.579E-2	387	0.035	0.052	3hj1B.pdb.gz	Structure of the Mitochondrial Editosome-Like Complex Associated TUTase 1 Reveals Divergent Mechanisms of UTP Selection and Domain Organization.
20	PDB:5iqr8	0.140	0.133	2.880E-2	615	0.083	0.078	5iqr8.pdb.gz	Ribosome-dependent activation of stringent control.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5JQP4	0.0	582	298	0.483	0.933	Q5JQP4_HUMAN DNA polymerase OS=Homo sapiens OX=9606 GN=POLL PE=1 SV=1
2	Q5JQP8	0.0	1006	487	0.847	1.000	Q5JQP8_HUMAN DNA polymerase OS=Homo sapiens OX=9606 GN=POLL PE=1 SV=1
3	Q9QXE2	0.0	932	573	0.824	0.827	DPOLL_MOUSE DNA polymerase lambda OS=Mus musculus OX=10090 GN=Poll PE=2 SV=1
4	Q9UGP5	0.0	1184	575	1.000	1.000	DPOLL_HUMAN DNA polymerase lambda OS=Homo sapiens OX=9606 GN=POLL PE=1 SV=1
5	Q9HBN3	2.96e-161	461	248	0.384	0.891	Q9HBN3_HUMAN DNA polymerase OS=Homo sapiens OX=9606 GN=POLL PE=1 SV=1
6	Q9FNY4	7.77e-71	238	529	0.303	0.329	DPOLL_ARATH DNA polymerase lambda OS=Arabidopsis thaliana OX=3702 GN=POLL PE=1 SV=1
7	Q67VC8	3.01e-70	238	549	0.289	0.302	DPOLL_ORYSJ DNA polymerase lambda OS=Oryza sativa subsp. japonica OX=39947 GN=POLL PE=1 SV=1
8	Q27958	2.17e-57	197	335	0.186	0.319	DPOLB_BOVIN DNA polymerase beta OS=Bos taurus OX=9913 GN=POLB PE=2 SV=3
9	Q8K409	3.40e-57	197	335	0.209	0.358	DPOLB_MOUSE DNA polymerase beta OS=Mus musculus OX=10090 GN=Polb PE=1 SV=3
10	P06746	5.91e-57	196	335	0.207	0.355	DPOLB_HUMAN DNA polymerase beta OS=Homo sapiens OX=9606 GN=POLB PE=1 SV=3
11	P06766	3.90e-56	194	335	0.205	0.352	DPOLB_RAT DNA polymerase beta OS=Rattus norvegicus OX=10116 GN=Polb PE=1 SV=4
12	Q6DRD3	1.15e-51	182	336	0.179	0.307	DPOLB_DANRE DNA polymerase beta OS=Danio rerio OX=7955 GN=polb PE=2 SV=2
13	Q9JIW4	2.49e-48	177	496	0.203	0.236	DPOLM_MOUSE DNA-directed DNA/RNA polymerase mu OS=Mus musculus OX=10090 GN=Polm PE=1 SV=2
14	Q9NP87	4.01e-48	177	494	0.200	0.233	DPOLM_HUMAN DNA-directed DNA/RNA polymerase mu OS=Homo sapiens OX=9606 GN=POLM PE=1 SV=1
15	P09838	6.01e-40	154	510	0.197	0.222	TDT_MOUSE DNA nucleotidylexotransferase OS=Mus musculus OX=10090 GN=Dntt PE=1 SV=4
16	Q09693	1.26e-39	153	506	0.256	0.291	DPO4_SCHPO DNA polymerase type-X family protein pol4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pol4 PE=3 SV=1
17	A0A8I6AFP2	2.20e-39	153	528	0.198	0.216	A0A8I6AFP2_RAT DNA nucleotidylexotransferase OS=Rattus norvegicus OX=10116 GN=Dntt PE=3 SV=1
18	Q5EB91	3.55e-39	152	510	0.193	0.218	Q5EB91_RAT DNA nucleotidylexotransferase OS=Rattus norvegicus OX=10116 GN=Dntt PE=2 SV=1
19	E9PT58	4.58e-39	152	510	0.193	0.218	E9PT58_RAT DNA nucleotidylexotransferase OS=Rattus norvegicus OX=10116 GN=Dntt PE=3 SV=1
20	P04053	1.51e-28	121	509	0.179	0.202	TDT_HUMAN DNA nucleotidylexotransferase OS=Homo sapiens OX=9606 GN=DNTT PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00533 BRCT	4.3e+02	12.7	BRCA1 C Terminus (BRCT) domain
2	PF16589 BRCT_2	3.3	19.5	BRCT domain, a BRCA1 C-terminus domain
3	PF11731 Cdd1	23	16.6	Pathogenicity locus
4	PF14792 DNA_pol_B_palm	2.1e-31	119.9	DNA polymerase beta palm
5	PF14791 DNA_pol_B_thumb	2.2e-18	77.4	DNA polymerase beta thumb
6	PF10391 DNA_pol_lambd_f	3.1e-18	76.6	Fingers domain of DNA polymerase lambda
7	PF00633 HHH	1.1e+02	14.1	Helix-hairpin-helix motif
8	PF14520 HHH_5	0.011	27.6	Helix-hairpin-helix domain
9	PF14716 HHH_8	2.6e-15	67.8	Helix-hairpin-helix domain
10	PF01909 NTP_transf_2	52	15.5	Nucleotidyltransferase domain
11	PF15347 PAG	1.5e+02	12.9	Phosphoprotein associated with glycosphingolipid-enriched

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359181

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258428	0.988	DNA repair protein REV1
2	9606.ENSP00000421491	0.975	DNA repair protein XRCC4
3	9606.ENSP00000484288	0.975	DNA ligase 4
4	9606.ENSP00000352257	0.969	X-ray repair cross-complementing protein 6
5	9606.ENSP00000368458	0.969	Proliferating cell nuclear antigen
6	9606.ENSP00000375978	0.962	X-ray repair cross-complementing protein 5
7	9606.ENSP00000349313	0.958	Non-homologous end-joining factor 1
8	9606.ENSP00000313420	0.947	DNA-dependent protein kinase catalytic subunit
9	9606.ENSP00000379174	0.941	DNA-directed DNA/RNA polymerase mu
10	9606.ENSP00000367527	0.923	Protein artemis
11	9606.ENSP00000351697	0.865	DNA polymerase zeta catalytic subunit
12	9606.ENSP00000230859	0.856	Non-canonical poly(A) RNA polymerase PAPD7
13	9606.ENSP00000361310	0.851	DNA polymerase eta
14	9606.ENSP00000235310	0.839	Mitotic spindle assembly checkpoint protein MAD2B
15	9606.ENSP00000241436	0.834	DNA polymerase kappa
16	9606.ENSP00000435506	0.816	DNA polymerase nu
17	9606.ENSP00000305480	0.807	Flap endonuclease 1
18	9606.ENSP00000359170	0.805	Protein DPCD
19	9606.ENSP00000262887	0.796	DNA repair protein XRCC1
20	9606.ENSP00000359149	0.785	F-box/WD repeat-containing protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003887	1.000	DNA-directed DNA polymerase activity
GO:0005515	0.999	protein binding
GO:0016835	0.977	carbon-oxygen lyase activity
GO:0051575	0.694	5'-deoxyribose-5-phosphate lyase activity
GO:0003676	0.379	nucleic acid binding
GO:0003677	0.309	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006974	0.995	cellular response to DNA damage stimulus
GO:0006259	0.995	DNA metabolic process
GO:0006281	0.994	DNA repair
GO:0006302	0.982	double-strand break repair
GO:0006284	0.971	base-excision repair
GO:0006310	0.969	DNA recombination
GO:0006303	0.956	double-strand break repair via nonhomologous end joining
GO:0034654	0.955	nucleobase-containing compound biosynthetic process
GO:0071897	0.930	DNA biosynthetic process
GO:0006289	0.913	nucleotide-excision repair
GO:0000725	0.896	recombinational repair
GO:0000724	0.892	double-strand break repair via homologous recombination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0005694	0.972	chromosome
GO:0090734	0.800	site of DNA damage
GO:0005737	0.674	cytoplasm
GO:0035861	0.645	site of double-strand break
GO:0032991	0.459	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.7.7	1.000	DNA-directed DNA polymerase.
EC:4.2.-.-	0.977	Carbon-oxygen lyases.

[back to server]