StarFunc result for job id Q9UGQ3

User Input

>input (507 residues)
MQEPLLGAEGPDYDTFPEKPPPSPGDRARVGTLQNKRVFLATFAAVLGNFSFGYALVYTS
PVIPALERSLDPDLHLTKSQASWFGSVFTLGAAAGGLSAMILNDLLGRKLSIMFSAVPSA
AGYALMAGAHGLWMLLLGRTLTGFAGGLTAACIPVYVSEIAPPGVRGALGATPQLMAVFG
SLSLYALGLLLPWRWLAVAGEAPVLIMILLLSFMPNSPRFLLSRGRDEEALRALAWLRGT
DVDVHWEFEQIQDNVRRQSSRVSWAEARAPHVCRPITVALLMRLLQQLTGITPILVYLQS
IFDSTAVLLPPKDDAAIVGAVRLLSVLIAALTMDLAGRKVLLFVSAAIMFAANLTLGLYI
HFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLLATMLFIMGYAVGWGPITWLL
MSEVLPLRARGVASGLCVLASWLTAFVLTKSFLPVVSTFGLQVPFFFFAAICLVSLVFTG
CCVPETKGRSLEQIESFFRTGRRSFLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UGQ3	1.000	1.000	8.926E-64	507	1.000	1.000	Q9UGQ3.pdb.gz	GTR6_HUMAN Solute carrier family 2, facilitated glucose transporter member 6 OS=Homo sapiens OX=9606 GN=SLC2A6 PE=1 SV=2
2	AFDB:Q3UDF0	0.879	0.896	2.038E-50	497	0.815	0.831	Q3UDF0.pdb.gz	GTR6_MOUSE Solute carrier family 2, facilitated glucose transporter member 6 OS=Mus musculus OX=10090 GN=Slc2a6 PE=1 SV=1
3	AFDB:F1RB41	0.881	0.911	4.469E-40	490	0.519	0.537	F1RB41.pdb.gz	F1RB41_DANRE Solute carrier family 2 member 6 OS=Danio rerio OX=7955 GN=slc2a6 PE=3 SV=1
4	AFDB:Q9NY64	0.782	0.829	3.057E-29	477	0.404	0.430	Q9NY64.pdb.gz	SL2A8_HUMAN Solute carrier family 2, facilitated glucose transporter member 8 OS=Homo sapiens OX=9606 GN=SLC2A8 PE=1 SV=3
5	AFDB:Q9JJZ1	0.788	0.833	4.978E-29	478	0.412	0.437	Q9JJZ1.pdb.gz	SL2A8_RAT Solute carrier family 2, facilitated glucose transporter member 8 OS=Rattus norvegicus OX=10116 GN=Slc2a8 PE=1 SV=1
6	AFDB:A9ZSY2	0.828	0.836	5.699E-28	502	0.280	0.283	A9ZSY2.pdb.gz	TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica OX=7469 GN=Tret1 PE=1 SV=1
7	AFDB:Q8MKK4	0.797	0.826	2.179E-27	488	0.290	0.301	Q8MKK4.pdb.gz	TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster OX=7227 GN=Tret1-2 PE=2 SV=1
8	AFDB:A5LGM7	0.788	0.792	4.007E-27	504	0.294	0.296	A5LGM7.pdb.gz	TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki OX=319348 GN=Tret1 PE=1 SV=1
9	AFDB:A1Z8N1	0.789	0.479	1.020E-26	857	0.300	0.177	A1Z8N1.pdb.gz	TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster OX=7227 GN=Tret1-1 PE=1 SV=1
10	AFDB:Q93YP9	0.794	0.824	1.107E-26	488	0.292	0.303	Q93YP9.pdb.gz	ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana OX=3702 GN=At1g19450 PE=2 SV=1
11	PDB:7sptA	0.794	0.853	5.592E-21	470	0.247	0.266	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
12	PDB:7wsmA	0.741	0.803	1.630E-19	464	0.256	0.280	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
13	PDB:4ybqB	0.765	0.836	9.356E-19	462	0.254	0.279	4ybqB.pdb.gz
14	PDB:4gbyA	0.761	0.809	1.057E-18	475	0.235	0.251	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
15	PDB:6thaA	0.717	0.804	1.146E-18	448	0.239	0.270	6thaA.pdb.gz
16	PDB:7aaqA	0.764	0.794	4.382E-18	487	0.249	0.259	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
17	PDB:4ja4A	0.663	0.750	1.162E-14	442	0.213	0.244	4ja4A.pdb.gz
18	PDB:7zh0A	0.647	0.662	8.507E-11	495	0.174	0.178	7zh0A.pdb.gz
19	PDB:6s4mA	0.561	0.656	2.839E-8	426	0.152	0.181	6s4mA.pdb.gz
20	PDB:6gs1A	0.531	0.564	2.653E-7	472	0.164	0.176	6gs1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1RB41	0.0	522	490	0.521	0.539	F1RB41_DANRE Solute carrier family 2 member 6 OS=Danio rerio OX=7955 GN=slc2a6 PE=3 SV=1
2	Q3UDF0	0.0	790	497	0.817	0.833	GTR6_MOUSE Solute carrier family 2, facilitated glucose transporter member 6 OS=Mus musculus OX=10090 GN=Slc2a6 PE=1 SV=1
3	Q9UGQ3	0.0	1003	507	1.000	1.000	GTR6_HUMAN Solute carrier family 2, facilitated glucose transporter member 6 OS=Homo sapiens OX=9606 GN=SLC2A6 PE=1 SV=2
4	Q9JJZ1	1.12e-101	315	478	0.422	0.448	SL2A8_RAT Solute carrier family 2, facilitated glucose transporter member 8 OS=Rattus norvegicus OX=10116 GN=Slc2a8 PE=1 SV=1
5	Q9JIF3	3.61e-100	311	477	0.418	0.444	SL2A8_MOUSE Solute carrier family 2, facilitated glucose transporter member 8 OS=Mus musculus OX=10090 GN=Slc2a8 PE=1 SV=2
6	Q9NY64	7.61e-96	300	477	0.420	0.447	SL2A8_HUMAN Solute carrier family 2, facilitated glucose transporter member 8 OS=Homo sapiens OX=9606 GN=SLC2A8 PE=1 SV=3
7	A5LGM7	1.67e-76	251	504	0.302	0.304	TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki OX=319348 GN=Tret1 PE=1 SV=1
8	Q8MKK4	2.69e-76	250	488	0.300	0.311	TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster OX=7227 GN=Tret1-2 PE=2 SV=1
9	A9ZSY2	5.89e-76	249	502	0.290	0.293	TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica OX=7469 GN=Tret1 PE=1 SV=1
10	A9ZSY3	1.47e-75	248	505	0.306	0.307	TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori OX=7091 GN=Tret1 PE=1 SV=1
11	Q7PIR5	1.96e-69	239	793	0.290	0.185	TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae OX=7165 GN=Tret1 PE=1 SV=3
12	Q9FRL3	1.66e-67	227	487	0.300	0.312	ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana OX=3702 GN=At1g75220 PE=1 SV=1
13	A1Z8N1	8.59e-65	227	857	0.296	0.175	TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster OX=7227 GN=Tret1-1 PE=1 SV=1
14	Q93YP9	1.71e-64	219	488	0.298	0.309	ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana OX=3702 GN=At1g19450 PE=2 SV=1
15	Q8IQH6	3.90e-64	217	471	0.266	0.287	Q8IQH6_DROME Nebulosa, isoform A OS=Drosophila melanogaster OX=7227 GN=nebu PE=1 SV=1
16	Q9VU17	9.28e-64	218	539	0.268	0.252	Q9VU17_DROME HL01062p OS=Drosophila melanogaster OX=7227 GN=nebu PE=1 SV=1
17	P93051	2.17e-61	210	463	0.312	0.341	ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana OX=3702 GN=At2g48020 PE=2 SV=2
18	Q0WQ63	6.81e-60	206	470	0.294	0.317	ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana OX=3702 GN=At3g05150 PE=2 SV=1
19	O04036	1.17e-59	206	496	0.288	0.294	ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana OX=3702 GN=ERD6 PE=1 SV=3
20	Q8GXK5	3.54e-56	196	482	0.310	0.326	EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana OX=3702 GN=At4g04750 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07690 MFS_1	7.6e-19	79.5	Major Facilitator Superfamily
2	PF00083 Sugar_tr	9.5e-78	273.7	Sugar (and other) transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360966

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263512	0.700	P3 protein
2	9606.ENSP00000275730	0.630	Solute carrier family 12 member 9
3	9606.ENSP00000266771	0.627	Solute carrier family 15 member 4
4	9606.ENSP00000236495	0.558	Sodium/glucose cotransporter 4
5	9606.ENSP00000395983	0.550	Solute carrier family 12 member 4
6	9606.ENSP00000263791	0.539	eIF-2-alpha kinase GCN2
7	9606.ENSP00000357915	0.534	Solute carrier family 22 member 16
8	9606.ENSP00000400325	0.509	Uncharacterized protein
9	9606.ENSP00000455064	0.509	Y+L amino acid transporter 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0055056	1.000	D-glucose transmembrane transporter activity
GO:0005488	0.998	binding
GO:0005515	0.983	protein binding
GO:0008514	0.926	organic anion transmembrane transporter activity
GO:0022804	0.698	active transmembrane transporter activity
GO:0015291	0.658	secondary active transmembrane transporter activity
GO:0015318	0.602	inorganic molecular entity transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0019220	0.986	regulation of phosphate metabolic process
GO:0043470	0.976	regulation of carbohydrate catabolic process
GO:1903578	0.976	regulation of ATP metabolic process
GO:0043467	0.975	regulation of generation of precursor metabolites and energy
GO:0006110	0.965	regulation of glycolytic process
GO:0071702	0.956	organic substance transport
GO:0008645	0.949	hexose transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0005737	0.990	cytoplasm
GO:0031090	0.977	organelle membrane
GO:0098588	0.947	bounding membrane of organelle
GO:0005764	0.860	lysosome
GO:0005765	0.847	lysosomal membrane
GO:0031982	0.622	vesicle
GO:0012505	0.377	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]