StarFunc result for job id Q9UGR2

User Input

>input (977 residues)
MERQKRKADIEKGLQFIQSTLPLKQEEYEAFLLKLVQNLFAEGNDLFREKDYKQALVQYM
EGLNVADYAASDQVALPRELLCKLHVNRAACYFTMGLYEKALEDSEKALGLDSESIRALF
RKARALNELGRHKEAYECSSRCSLALPHDESVTQLGQELAQKLGLRVRKAYKRPQELETF
SLLSNGTAAGVADQGTSNGLGSIDDIETDCYVDPRGSPALLPSTPTMPLFPHVLDLLAPL
DSSRTLPSTDSLDDFSDGDVFGPELDTLLDSLSLVQGGLSGSGVPSELPQLIPVFPGGTP
LLPPVVGGSIPVSSPLPPASFGLVMDPSKKLAASVLDALDPPGPTLDPLDLLPYSETRLD
ALDSFGSTRGSLDKPDSFMEETNSQDHRPPSGAQKPAPSPEPCMPNTALLIKNPLAATHE
FKQACQLCYPKTGPRAGDYTYREGLEHKCKRDILLGRLRSSEDQTWKRIRPRPTKTSFVG
SYYLCKDMINKQDCKYGDNCTFAYHQEEIDVWTEERKGTLNRDLLFDPLGGVKRGSLTIA
KLLKEHQGIFTFLCEICFDSKPRIISKGTKDSPSVCSNLAAKHSFYNNKCLVHIVRSTSL
KYSKIRQFQEHFQFDVCRHEVRYGCLREDSCHFAHSFIELKVWLLQQYSGMTHEDIVQES
KKYWQQMEAHAGKASSSMGAPRTHGPSTFDLQMKFVCGQCWRNGQVVEPDKDLKYCSAKA
RHCWTKERRVLLVMSKAKRKWVSVRPLPSIRNFPQQYDLCIHAQNGRKCQYVGNCSFAHS
PEERDMWTFMKENKILDMQQTYDMWLKKHNPGKPGEGTPISSREGEKQIQMPTDYADIMM
GYHCWLCGKNSNSKKQWQQHIQSEKHKEKVFTSDSDASGWAFRFPMGEFRLCDRLQKGKA
CPDGDKCRCAHGQEELNEWLDRREVLKQKLAKARKDMLLCPRDDDFGKYNFLLQEDGDLA
GATPEAPAAAATATTGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UGR2	1.000	1.000	0.000	977	1.000	1.000	Q9UGR2.pdb.gz	Z3H7B_HUMAN Zinc finger CCCH domain-containing protein 7B OS=Homo sapiens OX=9606 GN=ZC3H7B PE=1 SV=2
2	AFDB:Q9C0D5	0.124	0.068	2.288E-7	1861	0.079	0.041	Q9C0D5.pdb.gz	TANC1_HUMAN Protein TANC1 OS=Homo sapiens OX=9606 GN=TANC1 PE=1 SV=3
3	AFDB:Q0VGY8	0.126	0.069	4.905E-7	1856	0.079	0.041	Q0VGY8.pdb.gz	TANC1_MOUSE Protein TANC1 OS=Mus musculus OX=10090 GN=Tanc1 PE=1 SV=2
4	AFDB:A2A690	0.132	0.068	1.540E-6	1994	0.081	0.040	A2A690.pdb.gz	TANC2_MOUSE Protein TANC2 OS=Mus musculus OX=10090 GN=Tanc2 PE=1 SV=1
5	PDB:1ihgA	0.139	0.360	2.033E-6	364	0.031	0.082	1ihgA.pdb.gz
6	PDB:5njxA	0.130	0.298	4.094E-5	413	0.031	0.073	5njxA.pdb.gz	Combined x-ray crystallography and computational modeling approach to investigate the Hsp90 C-terminal peptide binding to FKBP51.
7	PDB:7dhgC	0.124	0.253	5.995E-5	470	0.033	0.068	7dhgC.pdb.gz
8	PDB:7obeA	0.117	0.231	6.287E-5	480	0.029	0.058	7obeA.pdb.gz	Conformational Change of Tetratricopeptide Repeats Region Triggers Activation of Phytochrome-Associated Protein Phosphatase 5.
9	PDB:5jheA	0.132	0.320	6.594E-5	388	0.034	0.085	5jheA.pdb.gz
10	PDB:7kw7E	0.121	0.348	9.206E-5	327	0.034	0.101	7kw7E.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
11	PDB:6n3qF	0.127	0.564	2.505E-4	190	0.037	0.189	6n3qF.pdb.gz
12	PDB:2c2lA	0.096	0.327	5.119E-4	281	0.035	0.121	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
13	PDB:4nrhB	0.113	0.561	6.497E-4	170	0.020	0.118	4nrhB.pdb.gz
14	PDB:1wao1	0.116	0.234	7.496E-4	471	0.037	0.076	1wao1.pdb.gz	Molecular Basis for Tpr Domain-Mediated Regulation of Protein Phosphatase 5
15	AFDB:O60184	0.113	0.101	1.217E-3	1102	0.061	0.054	O60184.pdb.gz	CYC8_SCHPO General transcriptional corepressor ssn6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssn6 PE=1 SV=1
16	AFDB:F4HS99	0.123	0.069	1.473E-3	1797	0.061	0.033	F4HS99.pdb.gz	REC1_ARATH Protein REDUCED CHLOROPLAST COVERAGE 1 OS=Arabidopsis thaliana OX=3702 GN=REC1 PE=1 SV=1
17	AFDB:F4HZK4	0.111	0.069	1.473E-3	1608	0.069	0.042	F4HZK4.pdb.gz	REC3_ARATH Protein REDUCED CHLOROPLAST COVERAGE 3 OS=Arabidopsis thaliana OX=3702 GN=REC3 PE=3 SV=1
18	AFDB:A0A0G2K6D0	0.110	0.081	2.609E-3	1366	0.076	0.054	A0A0G2K6D0.pdb.gz	A0A0G2K6D0_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=2
19	AFDB:O15550	0.110	0.078	3.642E-3	1401	0.073	0.051	O15550.pdb.gz	KDM6A_HUMAN Lysine-specific demethylase 6A OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=2
20	AFDB:P33981	0.098	0.110	9.448E-3	857	0.071	0.081	P33981.pdb.gz	TTK_HUMAN Dual specificity protein kinase TTK OS=Homo sapiens OX=9606 GN=TTK PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IWR0	0.0	879	971	0.470	0.473	Z3H7A_HUMAN Zinc finger CCCH domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZC3H7A PE=1 SV=1
2	Q9UGR2	0.0	2033	977	1.000	1.000	Z3H7B_HUMAN Zinc finger CCCH domain-containing protein 7B OS=Homo sapiens OX=9606 GN=ZC3H7B PE=1 SV=2
3	E9QAM5	1.33e-13	78.2	2947	0.069	0.023	HELZ2_MOUSE Helicase with zinc finger domain 2 OS=Mus musculus OX=10090 GN=Helz2 PE=1 SV=1
4	Q567I0	1.55e-13	73.2	218	0.052	0.234	Q567I0_DANRE Unc-45 homolog A (C. elegans) OS=Danio rerio OX=7955 GN=zgc:112031 PE=1 SV=1
5	O13754	3.43e-11	68.6	358	0.050	0.137	CNS1_SCHPO Hsp70/Hsp90 co-chaperone cns1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cns1 PE=3 SV=1
6	Q8CGY6	1.24e-10	68.2	931	0.045	0.047	UN45B_MOUSE Protein unc-45 homolog B OS=Mus musculus OX=10090 GN=Unc45b PE=1 SV=1
7	A0A1W2PNX8	2.12e-10	67.4	1084	0.045	0.041	A0A1W2PNX8_HUMAN Unc-45 myosin chaperone A OS=Homo sapiens OX=9606 GN=UNC45A PE=1 SV=1
8	Q9H3U1	2.54e-10	67.0	944	0.045	0.047	UN45A_HUMAN Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A PE=1 SV=1
9	Q99KD5	1.58e-09	64.3	944	0.044	0.046	UN45A_MOUSE Protein unc-45 homolog A OS=Mus musculus OX=10090 GN=Unc45a PE=1 SV=2
10	Q8IWX7	2.49e-09	63.9	931	0.048	0.050	UN45B_HUMAN Protein unc-45 homolog B OS=Homo sapiens OX=9606 GN=UNC45B PE=1 SV=1
11	Q9SIN1	3.04e-09	63.2	691	0.042	0.059	TTL3_ARATH Inactive TPR repeat-containing thioredoxin TTL3 OS=Arabidopsis thaliana OX=3702 GN=TTL3 PE=1 SV=2
12	Q84JR9	1.85e-08	60.8	682	0.038	0.054	TTL4_ARATH TPR repeat-containing thioredoxin TTL4 OS=Arabidopsis thaliana OX=3702 GN=TTL4 PE=2 SV=1
13	B6GVA2	2.64e-08	58.5	261	0.040	0.149	B6GVA2_SOLLC Tetratricopeptide repeat protein OS=Solanum lycopersicum OX=4081 GN=int106 PE=1 SV=1
14	Q9MAH1	4.08e-08	59.7	699	0.038	0.053	TTL1_ARATH TPR repeat-containing thioredoxin TTL1 OS=Arabidopsis thaliana OX=3702 GN=TTL1 PE=1 SV=1
15	Q15785	7.08e-08	57.8	309	0.038	0.120	TOM34_HUMAN Mitochondrial import receptor subunit TOM34 OS=Homo sapiens OX=9606 GN=TOMM34 PE=1 SV=2
16	Q496Y0	7.79e-08	58.9	759	0.039	0.050	LONF3_HUMAN LON peptidase N-terminal domain and RING finger protein 3 OS=Homo sapiens OX=9606 GN=LONRF3 PE=1 SV=1
17	Q6DGE9	9.04e-08	58.9	934	0.037	0.039	UN45B_DANRE Protein unc-45 homolog B OS=Danio rerio OX=7955 GN=unc45b PE=1 SV=2
18	Q9HGM9	1.22e-07	57.8	476	0.045	0.092	DNJC7_SCHPO DnaJ homolog subfamily C member 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC543.02c PE=4 SV=1
19	Q9CYG7	3.50e-07	55.5	309	0.037	0.117	TOM34_MOUSE Mitochondrial import receptor subunit TOM34 OS=Mus musculus OX=10090 GN=Tomm34 PE=1 SV=1
20	O48802	1.17e-06	55.1	751	0.045	0.059	PHOX2_ARATH Protein CLMP1 OS=Arabidopsis thaliana OX=3702 GN=CLMP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	0.18	23.4	Anaphase-promoting complex, cyclosome, subunit 3
2	PF12968 DUF3856	3.9e+02	12.5	Domain of Unknown Function (DUF3856)
3	PF00515 TPR_1	2.5e-05	35.1	Tetratricopeptide repeat
4	PF13414 TPR_11	1.3e+02	13.6	TPR repeat
5	PF13424 TPR_12	0.001	30.7	Tetratricopeptide repeat
6	PF13432 TPR_16	9.8e+02	11.8	Tetratricopeptide repeat
7	PF14559 TPR_19	4.4e+02	12.7	Tetratricopeptide repeat
8	PF07719 TPR_2	0.98	20.7	Tetratricopeptide repeat
9	PF13181 TPR_8	0.019	26.2	Tetratricopeptide repeat
10	PF13371 TPR_9	5.3e+02	12.1	Tetratricopeptide repeat
11	PF12756 zf-C2H2_2	5.3	18.8	C2H2 type zinc-finger (2 copies)
12	PF12171 zf-C2H2_jaz	52	15.5	Zinc-finger double-stranded RNA-binding
13	PF00642 zf-CCCH	7.8e-09	46.5	Zinc finger C-x8-C-x5-C-x3-H type (and similar)
14	PF18044 zf-CCCH_4	36	15.6	CCCH-type zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345793

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000317817	0.954	SH2 domain-containing protein 3C
2	9606.ENSP00000367705	0.812	BCL-6 corepressor
3	9606.ENSP00000421180	0.782	Mastermind-like protein 3
4	9606.ENSP00000362166	0.714	Chromatin modification-related protein MEAF6
5	9606.ENSP00000365210	0.713	G2/mitotic-specific cyclin-B3
6	9606.ENSP00000416255	0.682	Eukaryotic translation initiation factor 4 gamma 1
7	9606.ENSP00000342680	0.681	Uncharacterized protein CXorf67
8	9606.ENSP00000394623	0.656	NUT family member 2B
9	9606.ENSP00000363640	0.644	PHD finger protein 1
10	9606.ENSP00000283928	0.631	Juxtaposed with another zinc finger protein 1
11	9606.ENSP00000371126	0.622	NUT family member 2A
12	9606.ENSP00000468304	0.607	MBT domain-containing protein 1
13	9606.ENSP00000264335	0.578	14-3-3 protein epsilon
14	9606.ENSP00000361397	0.573	NUT family member 2G
15	9606.ENSP00000437775	0.521	BCL-6 corepressor-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0035198	0.999	miRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0009987	0.994	cellular process
GO:0060255	0.993	regulation of macromolecule metabolic process
GO:0010468	0.982	regulation of gene expression
GO:0071704	0.979	organic substance metabolic process
GO:0044238	0.976	primary metabolic process
GO:0048519	0.974	negative regulation of biological process
GO:0006807	0.968	nitrogen compound metabolic process
GO:0043170	0.963	macromolecule metabolic process
GO:0044237	0.962	cellular metabolic process
GO:0010605	0.954	negative regulation of macromolecule metabolic process
GO:0034641	0.930	cellular nitrogen compound metabolic process
GO:0090304	0.912	nucleic acid metabolic process
GO:0010608	0.898	post-transcriptional regulation of gene expression
GO:0035196	0.885	miRNA processing
GO:0050794	0.410	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0005634	0.989	nucleus
GO:0043233	0.959	organelle lumen
GO:0031981	0.948	nuclear lumen
GO:0005654	0.876	nucleoplasm
GO:0005737	0.795	cytoplasm
GO:0032991	0.694	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]