StarFunc result for job id Q9UGT4

User Input

>input (822 residues)
MKPALLPWALLLLATALGPGPGPTADAQESCSMRCGALDGPCSCHPTCSGLGTCCLDFRD
FCLEILPYSGSMMGGKDFVVRHFKMSSPTDASVICRFKDSIQTLGHVDSSGQVHCVSPLL
YESGRIPFTVSLDNGHSFPRAGTWLAVHPNKVSMMEKSELVNETRWQYYGTANTSGNLSL
TWHVKSLPTQTITIELWGYEETGMPYSQEWTAKWSYLYPLATHIPNSGSFTFTPKPAPPS
YQRWRVGALRIIDSKNYAGQKDVQALWTNDHALAWHLSDDFREDPVAWARTQCQAWEELE
DQLPNFLEELPDCPCTLTQARADSGRFFTDYGCDMEQGSVCTYHPGAVHCVRSVQASLRY
GSGQQCCYTADGTQLLTADSSGGSTPDRGHDWGAPPFRTPPRVPSMSHWLYDVLSFYYCC
LWAPDCPRYMQRRPSNDCRNYRPPRLASAFGDPHFVTFDGTNFTFNGRGEYVLLEAALTD
LRVQARAQPGTMSNGTETRGTGLTAVAVQEGNSDVVEVRLANRTGGLEVLLNQEVLSFTE
QSWMDLKGMFLSVAAGDRVSIMLASGAGLEVSVQGPFLSVSVLLPEKFLTHTHGLLGTLN
NDPTDDFTLHSGRVLPPGTSPQELFLFGANWTVHNASSLLTYDSWFLVHNFLYQPKHDPT
FEPLFPSETTLNPSLAQEAAKLCGDDHFCNFDVAATGSLSTGTATRVAHQLHQRRMQSLQ
PVVSCGWLAPPPNGQKEGNRYLAGSTIYFHCDNGYSLAGAETSTCQADGTWSSPTPKCQP
GRSYAVLLGIIFGGLAVVAAVALVYVLLRRRKGNTHVWGAQP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VJW3	0.973	0.973	0.000	822	1.000	1.000	A0A140VJW3.pdb.gz	A0A140VJW3_HUMAN Sushi domain containing 2, isoform CRA_a OS=Homo sapiens OX=9606 GN=SUSD2 PE=2 SV=1
2	AFDB:Q0KHY3	0.776	0.451	9.812E-69	1454	0.283	0.160	Q0KHY3.pdb.gz	MESH_DROME Protein mesh OS=Drosophila melanogaster OX=7227 GN=mesh PE=1 SV=2
3	AFDB:Q99102	0.430	0.174	1.911E-30	2169	0.198	0.075	Q99102.pdb.gz	MUC4_HUMAN Mucin-4 OS=Homo sapiens OX=9606 GN=MUC4 PE=1 SV=5
4	AFDB:Q63661	0.320	0.120	5.813E-22	2344	0.106	0.037	Q63661.pdb.gz	MUC4_RAT Mucin-4 OS=Rattus norvegicus OX=10116 GN=Muc4 PE=1 SV=2
5	AFDB:Q80Z19	0.232	0.079	1.226E-14	2680	0.086	0.026	Q80Z19.pdb.gz	MUC2_MOUSE Mucin-2 OS=Mus musculus OX=10090 GN=Muc2 PE=1 SV=3
6	AFDB:Q9GYX3	0.258	0.281	5.464E-14	751	0.089	0.097	Q9GYX3.pdb.gz	Q9GYX3_DROME Crossveinless 2 OS=Drosophila melanogaster OX=7227 GN=cv-2 PE=2 SV=2
7	AFDB:Q28983	0.219	0.080	1.768E-13	2476	0.080	0.027	Q28983.pdb.gz	ZAN_PIG Zonadhesin OS=Sus scrofa OX=9823 GN=ZAN PE=1 SV=1
8	AFDB:Q9CV93	0.221	0.249	2.189E-13	725	0.082	0.092	Q9CV93.pdb.gz	Q9CV93_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1
9	AFDB:E9Q0B5	0.254	0.086	2.309E-13	2583	0.095	0.030	E9Q0B5.pdb.gz	E9Q0B5_MOUSE Fc fragment of IgG binding protein OS=Mus musculus OX=10090 GN=Fcgbp PE=1 SV=1
10	AFDB:Q8CJ69	0.230	0.272	2.309E-13	685	0.078	0.093	Q8CJ69.pdb.gz	BMPER_MOUSE BMP-binding endothelial regulator protein OS=Mus musculus OX=10090 GN=Bmper PE=1 SV=1
11	PDB:6z3mc	0.132	0.595	8.573E-7	158	0.039	0.203	6z3mc.pdb.gz	Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.
12	PDB:4lnvA	0.083	0.062	8.442E-5	1276	0.066	0.042	4lnvA.pdb.gz
13	PDB:5a42A	0.097	0.060	8.905E-5	1597	0.052	0.027	5a42A.pdb.gz
14	PDB:2gsxA	0.070	0.061	1.045E-4	951	0.100	0.086	2gsxA.pdb.gz
15	PDB:4ziqA	0.099	0.068	2.092E-4	1450	0.050	0.028	4ziqA.pdb.gz
16	PDB:7q1yA	0.087	0.064	2.881E-4	1374	0.062	0.037	7q1yA.pdb.gz
17	PDB:7z0lB	0.083	0.149	5.765E-4	370	0.044	0.097	7z0lB.pdb.gz
18	PDB:2xwbF	0.063	0.072	6.415E-4	714	0.028	0.032	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
19	PDB:1a8jL	0.089	0.257	1.428E-3	216	0.029	0.111	1a8jL.pdb.gz	Treatment of osteoarthritis with aspartame.
20	PDB:1c1zA	0.068	0.170	1.676E-3	326	0.022	0.055	1c1zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VJW3	0.0	1704	822	1.000	1.000	A0A140VJW3_HUMAN Sushi domain containing 2, isoform CRA_a OS=Homo sapiens OX=9606 GN=SUSD2 PE=2 SV=1
2	Q9UGT4	0.0	1704	822	1.000	1.000	SUSD2_HUMAN Sushi domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SUSD2 PE=1 SV=1
3	Q0KHY3	7.43e-85	298	1454	0.287	0.162	MESH_DROME Protein mesh OS=Drosophila melanogaster OX=7227 GN=mesh PE=1 SV=2
4	Q8JZM8	5.99e-29	127	3470	0.114	0.027	MUC4_MOUSE Mucin-4 OS=Mus musculus OX=10090 GN=Muc4 PE=2 SV=2
5	Q99102	1.41e-27	123	5412	0.123	0.019	MUC4_HUMAN Mucin-4 OS=Homo sapiens OX=9606 GN=MUC4 PE=1 SV=5
6	Q63661	4.00e-19	95.9	2344	0.096	0.034	MUC4_RAT Mucin-4 OS=Rattus norvegicus OX=10116 GN=Muc4 PE=1 SV=2
7	Q28983	4.07e-10	66.2	2476	0.069	0.023	ZAN_PIG Zonadhesin OS=Sus scrofa OX=9823 GN=ZAN PE=1 SV=1
8	Q9GYX3	9.93e-09	61.2	751	0.073	0.080	Q9GYX3_DROME Crossveinless 2 OS=Drosophila melanogaster OX=7227 GN=cv-2 PE=2 SV=2
9	Q9W2H2	1.48e-08	60.8	751	0.073	0.080	Q9W2H2_DROME Crossveinless 2 OS=Drosophila melanogaster OX=7227 GN=cv-2 PE=2 SV=2
10	Q3U492	4.62e-08	59.7	1550	0.077	0.041	KCP_MOUSE Kielin/chordin-like protein OS=Mus musculus OX=10090 GN=Kcp PE=1 SV=2
11	Q501P1	4.96e-08	58.5	440	0.030	0.057	FBLN7_MOUSE Fibulin-7 OS=Mus musculus OX=10090 GN=Fbln7 PE=1 SV=1
12	Q80Z19	1.05e-07	58.5	2680	0.078	0.024	MUC2_MOUSE Mucin-2 OS=Mus musculus OX=10090 GN=Muc2 PE=1 SV=3
13	Q923L3	3.14e-07	57.0	3564	0.032	0.007	CSMD1_MOUSE CUB and sushi domain-containing protein 1 OS=Mus musculus OX=10090 GN=Csmd1 PE=1 SV=2
14	O35888	3.57e-07	56.6	1034	0.068	0.054	O35888_RAT Mucin OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=2 SV=1
15	Q96PZ7	4.01e-07	56.6	3564	0.032	0.007	CSMD1_HUMAN CUB and sushi domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CSMD1 PE=1 SV=3
16	Q62635	4.55e-07	56.2	1513	0.062	0.034	MUC2_RAT Mucin-2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Muc2 PE=1 SV=1
17	O88799	5.47e-07	56.2	5376	0.063	0.010	ZAN_MOUSE Zonadhesin OS=Mus musculus OX=10090 GN=Zan PE=1 SV=1
18	A2AVA0	1.00e-06	55.5	3567	0.030	0.007	SVEP1_MOUSE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Svep1 PE=1 SV=1
19	Q9Y6R7	1.01e-06	55.5	5405	0.060	0.009	FCGBP_HUMAN IgGFc-binding protein OS=Homo sapiens OX=9606 GN=FCGBP PE=1 SV=3
20	A0A0G2K1Y4	1.23e-06	55.1	3586	0.066	0.015	A0A0G2K1Y4_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03782 AMOP	1.6e-53	192.3	AMOP domain
2	PF01033 Somatomedin_B	0.0094	27.6	Somatomedin B domain
3	PF00084 Sushi	2.2e-08	45.7	Sushi repeat (SCR repeat)
4	PF00094 VWD	1.5e-14	66.1	von Willebrand factor type D domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351075

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341490	0.769	Isthmin-2
2	9606.ENSP00000361199	0.707	Protein GPR15L
3	9606.ENSP00000374234	0.616	Transmembrane protein 72
4	9606.ENSP00000262487	0.578	Isthmin-1
5	9606.ENSP00000220562	0.577	Exostosin-like 3
6	9606.ENSP00000215909	0.561	Galectin-1
7	9606.ENSP00000291527	0.542	Trefoil factor 1
8	9606.ENSP00000267584	0.541	Adenylate kinase 7
9	9606.ENSP00000339250	0.540	Developmental pluripotency-associated protein 3
10	9606.ENSP00000362464	0.521	Gap junction beta-3 protein
11	9606.ENSP00000357591	0.515	Trafficking protein particle complex subunit 3-like protein
12	9606.ENSP00000353824	0.509	Serine/threonine-protein kinase pim-3
13	9606.ENSP00000264036	0.504	Cell surface glycoprotein MUC18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048523	0.994	negative regulation of cellular process
GO:0051302	0.991	regulation of cell division
GO:0051726	0.975	regulation of cell cycle
GO:1902806	0.972	regulation of cell cycle G1/S phase transition
GO:0051782	0.972	negative regulation of cell division
GO:1901988	0.958	negative regulation of cell cycle phase transition
GO:1902807	0.895	negative regulation of cell cycle G1/S phase transition
GO:0009987	0.614	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005576	0.978	extracellular region
GO:0043226	0.976	organelle
GO:0043227	0.969	membrane-bounded organelle
GO:0005615	0.882	extracellular space
GO:0005622	0.756	intracellular anatomical structure
GO:0031982	0.737	vesicle
GO:0043230	0.707	extracellular organelle
GO:0043231	0.700	intracellular membrane-bounded organelle
GO:1903561	0.695	extracellular vesicle
GO:0070062	0.640	extracellular exosome
GO:0005737	0.554	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]