StarFunc result for job id Q9UH62

User Input

>input (379 residues)
MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDAGDCSGARYNDW
SDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSP
QELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVK
EKALIVLNNLSVNAENQRRLKVYMNQVCDDTITSRLNSSVQLAGLRLLTNMTVTNEYQHM
LANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE
VILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKV
KVGKFMAKLAEHMFPKSQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BHS6	0.867	0.867	5.578E-43	379	0.966	0.966	Q8BHS6.pdb.gz	ARMX3_MOUSE Armadillo repeat-containing X-linked protein 3 OS=Mus musculus OX=10090 GN=Armcx3 PE=1 SV=1
2	AFDB:Q8N2F6	0.644	0.709	1.104E-22	343	0.443	0.490	Q8N2F6.pdb.gz	ARM10_HUMAN Armadillo repeat-containing protein 10 OS=Homo sapiens OX=9606 GN=ARMC10 PE=1 SV=1
3	AFDB:Q9CX83	0.634	0.531	1.417E-22	456	0.472	0.393	Q9CX83.pdb.gz	ARMX1_MOUSE Armadillo repeat-containing X-linked protein 1 OS=Mus musculus OX=10090 GN=Armcx1 PE=1 SV=1
4	AFDB:Q9P291	0.628	0.530	1.043E-21	453	0.478	0.400	Q9P291.pdb.gz	ARMX1_HUMAN Armadillo repeat-containing X-linked protein 1 OS=Homo sapiens OX=9606 GN=ARMCX1 PE=1 SV=1
5	AFDB:Q9D0L7	0.630	0.773	6.774E-21	306	0.417	0.516	Q9D0L7.pdb.gz	ARM10_MOUSE Armadillo repeat-containing protein 10 OS=Mus musculus OX=10090 GN=Armc10 PE=1 SV=1
6	AFDB:Q5H9R4	0.638	0.109	2.017E-18	2290	0.346	0.057	Q5H9R4.pdb.gz	ARMX4_HUMAN Armadillo repeat-containing X-linked protein 4 OS=Homo sapiens OX=9606 GN=ARMCX4 PE=1 SV=3
7	AFDB:H7C2M7	0.321	0.576	1.797E-8	185	0.235	0.481	H7C2M7.pdb.gz	H7C2M7_HUMAN Armadillo repeat containing 10 (Fragment) OS=Homo sapiens OX=9606 GN=ARMC10 PE=1 SV=1
8	AFDB:Q5T9G4	0.550	0.606	2.794E-7	340	0.142	0.159	Q5T9G4.pdb.gz	ARM12_HUMAN Armadillo repeat-containing protein 12 OS=Homo sapiens OX=9606 GN=ARMC12 PE=1 SV=1
9	AFDB:Q80X86	0.537	0.592	5.001E-7	340	0.127	0.141	Q80X86.pdb.gz	ARM12_MOUSE Armadillo repeat-containing protein 12 OS=Mus musculus OX=10090 GN=Armc12 PE=1 SV=1
10	AFDB:Q6P1M9	0.394	0.276	7.580E-7	558	0.230	0.156	Q6P1M9.pdb.gz	ARMX5_HUMAN Armadillo repeat-containing X-linked protein 5 OS=Homo sapiens OX=9606 GN=ARMCX5 PE=1 SV=1
11	PDB:6kbnC	0.496	0.384	1.142E-4	504	0.119	0.089	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
12	PDB:1wa5B	0.523	0.435	1.528E-4	466	0.111	0.090	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
13	PDB:5tbkA	0.401	0.373	2.315E-4	417	0.121	0.110	5tbkA.pdb.gz
14	PDB:3tpoA	0.529	0.463	2.734E-4	438	0.087	0.075	3tpoA.pdb.gz
15	PDB:7anwA	0.306	0.190	2.971E-4	645	0.103	0.060	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
16	PDB:4tnmA	0.497	0.467	3.098E-4	407	0.098	0.091	4tnmA.pdb.gz
17	PDB:7rroH7	0.450	0.307	4.894E-4	580	0.127	0.083	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
18	PDB:7cm7A	0.302	0.194	1.327E-3	620	0.098	0.060	7cm7A.pdb.gz	The NAD + -mediated self-inhibition mechanism of pro-neurodegenerative SARM1.
19	PDB:2z6gA	0.486	0.352	1.568E-3	550	0.100	0.069	2z6gA.pdb.gz
20	PDB:4r0zA	0.456	0.322	3.179E-3	557	0.084	0.057	4r0zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BHS6	0.0	669	379	0.966	0.966	ARMX3_MOUSE Armadillo repeat-containing X-linked protein 3 OS=Mus musculus OX=10090 GN=Armcx3 PE=1 SV=1
2	Q9UH62	0.0	785	379	1.000	1.000	ARMX3_HUMAN Armadillo repeat-containing X-linked protein 3 OS=Homo sapiens OX=9606 GN=ARMCX3 PE=1 SV=1
3	Q9P291	6.77e-104	315	453	0.475	0.397	ARMX1_HUMAN Armadillo repeat-containing X-linked protein 1 OS=Homo sapiens OX=9606 GN=ARMCX1 PE=1 SV=1
4	Q9CX83	2.60e-94	291	456	0.375	0.311	ARMX1_MOUSE Armadillo repeat-containing X-linked protein 1 OS=Mus musculus OX=10090 GN=Armcx1 PE=1 SV=1
5	Q8N2F6	3.26e-94	287	343	0.454	0.501	ARM10_HUMAN Armadillo repeat-containing protein 10 OS=Homo sapiens OX=9606 GN=ARMC10 PE=1 SV=1
6	Q9D0L7	3.19e-80	250	306	0.343	0.425	ARM10_MOUSE Armadillo repeat-containing protein 10 OS=Mus musculus OX=10090 GN=Armc10 PE=1 SV=1
7	Q5H9R4	1.58e-72	248	2290	0.309	0.051	ARMX4_HUMAN Armadillo repeat-containing X-linked protein 4 OS=Homo sapiens OX=9606 GN=ARMCX4 PE=1 SV=3
8	H7C2M7	3.34e-49	166	185	0.245	0.503	H7C2M7_HUMAN Armadillo repeat containing 10 (Fragment) OS=Homo sapiens OX=9606 GN=ARMC10 PE=1 SV=1
9	Q6P1M9	1.00e-40	153	558	0.245	0.167	ARMX5_HUMAN Armadillo repeat-containing X-linked protein 5 OS=Homo sapiens OX=9606 GN=ARMCX5 PE=1 SV=1
10	Q5JY77	8.32e-32	129	1395	0.182	0.049	GASP1_HUMAN G-protein coupled receptor-associated sorting protein 1 OS=Homo sapiens OX=9606 GN=GPRASP1 PE=1 SV=3
11	Q8BUY8	1.16e-31	129	826	0.174	0.080	GASP2_MOUSE G-protein coupled receptor-associated sorting protein 2 OS=Mus musculus OX=10090 GN=Gprasp2 PE=1 SV=2
12	Q96D09	4.02e-31	127	838	0.187	0.085	GASP2_HUMAN G-protein coupled receptor-associated sorting protein 2 OS=Homo sapiens OX=9606 GN=GPRASP2 PE=1 SV=1
13	Q920R4	8.93e-31	126	1346	0.172	0.048	GASP1_RAT G-protein coupled receptor-associated sorting protein 1 OS=Rattus norvegicus OX=10116 GN=Gprasp1 PE=1 SV=1
14	Q6PI77	1.07e-30	125	547	0.172	0.119	GASP3_HUMAN G protein-coupled receptor associated sorting protein 3 OS=Homo sapiens OX=9606 GN=GPRASP3 PE=1 SV=1
15	Q5U4C1	1.30e-29	123	1347	0.169	0.048	GASP1_MOUSE G-protein coupled receptor-associated sorting protein 1 OS=Mus musculus OX=10090 GN=Gprasp1 PE=1 SV=1
16	C9J5N7	7.33e-28	111	233	0.224	0.365	C9J5N7_HUMAN Armadillo repeat containing 10 (Fragment) OS=Homo sapiens OX=9606 GN=ARMC10 PE=1 SV=1
17	Q6PB60	1.14e-25	110	539	0.156	0.109	GASP3_MOUSE G protein-coupled receptor associated sorting protein 3 OS=Mus musculus OX=10090 GN=Gprasp3 PE=1 SV=1
18	Q5T9G4	0.006	40.8	340	0.156	0.174	ARM12_HUMAN Armadillo repeat-containing protein 12 OS=Homo sapiens OX=9606 GN=ARMC12 PE=1 SV=1
19	P14923	0.008	40.8	745	0.124	0.063	PLAK_HUMAN Junction plakoglobin OS=Homo sapiens OX=9606 GN=JUP PE=1 SV=3
20	Q02257	0.008	40.8	745	0.124	0.063	PLAK_MOUSE Junction plakoglobin OS=Mus musculus OX=10090 GN=Jup PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00514 Arm	21	16.6	Armadillo/beta-catenin-like repeat
2	PF04826 Arm_2	6.4e-96	331.7	Armadillo-like
3	PF09759 Atx10homo_assoc	0.6	21.4	Spinocerebellar ataxia type 10 protein domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000340672

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328875	0.902	Trafficking kinesin-binding protein 2
2	9606.ENSP00000380093	0.850	Transcription factor SOX-10
3	9606.ENSP00000238788	0.751	Transmembrane protein 214
4	9606.ENSP00000369395	0.737	Leucine-rich repeat-containing protein 19
5	9606.ENSP00000333934	0.720	tRNA (guanine(10)-N2)-methyltransferase homolog
6	9606.ENSP00000384966	0.686	Mitochondrial inner membrane protease subunit 2
7	9606.ENSP00000423276	0.682	Zinc finger CCHC-type containing 10
8	9606.ENSP00000361824	0.645	Spectrin alpha chain, non-erythrocytic 1
9	9606.ENSP00000338034	0.517	SPRY domain containing 4
10	9606.ENSP00000276569	0.501	Armadillo repeat containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0065007	0.981	biological regulation
GO:0051179	0.974	localization
GO:0050794	0.971	regulation of cellular process
GO:0006810	0.956	transport
GO:0051646	0.939	mitochondrion localization
GO:0071840	0.908	cellular component organization or biogenesis
GO:0016043	0.904	cellular component organization
GO:0007018	0.882	microtubule-based movement
GO:0048518	0.881	positive regulation of biological process
GO:0099111	0.879	microtubule-based transport
GO:0034643	0.836	establishment of mitochondrion localization, microtubule-mediated
GO:0051641	0.811	cellular localization
GO:0060255	0.768	regulation of macromolecule metabolic process
GO:0048522	0.757	positive regulation of cellular process
GO:0010970	0.742	transport along microtubule
GO:0072384	0.728	organelle transport along microtubule
GO:0006996	0.683	organelle organization
GO:0098930	0.653	axonal transport
GO:0007005	0.523	mitochondrion organization
GO:0031323	0.519	regulation of cellular metabolic process
GO:0051171	0.506	regulation of nitrogen compound metabolic process
GO:0080090	0.500	regulation of primary metabolic process
GO:0010468	0.446	regulation of gene expression
GO:0047497	0.434	mitochondrion transport along microtubule
GO:0019219	0.415	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.411	regulation of cellular biosynthetic process
GO:0010556	0.409	regulation of macromolecule biosynthetic process
GO:0051252	0.345	regulation of RNA metabolic process
GO:0009893	0.338	positive regulation of metabolic process
GO:0010604	0.333	positive regulation of macromolecule metabolic process
GO:0006355	0.332	regulation of DNA-templated transcription
GO:0031325	0.322	positive regulation of cellular metabolic process
GO:0010557	0.315	positive regulation of macromolecule biosynthetic process
GO:0031328	0.314	positive regulation of cellular biosynthetic process
GO:0051173	0.311	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.999	membrane
GO:0031090	0.981	organelle membrane
GO:0005634	0.972	nucleus
GO:0005829	0.970	cytosol
GO:0098588	0.857	bounding membrane of organelle
GO:0031975	0.856	envelope
GO:0031967	0.854	organelle envelope
GO:0031966	0.836	mitochondrial membrane
GO:0031968	0.699	organelle outer membrane
GO:0005741	0.675	mitochondrial outer membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]