StarFunc result for job id Q9UH92

User Input

>input (298 residues)
MTEPGASPEDPWVKASPVGAHAGEGRAGRARARRGAGRRGASLLSPKSPTLSVPRGCRED
SSHPACAKVEYAYSDNSLDPGLFVESTRKGSVVSRANSIGSTSASSVPNTDDEDSDYHQE
AYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKT
IDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFN
VFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O08609	0.784	0.784	3.959E-40	298	0.956	0.956	O08609.pdb.gz	MLX_MOUSE Max-like protein X OS=Mus musculus OX=10090 GN=Mlx PE=1 SV=1
2	AFDB:Q9GQP6	0.401	0.466	2.786E-15	254	0.319	0.374	Q9GQP6.pdb.gz	Q9GQP6_DROME BHLHZip transcription factor BIGMAX OS=Drosophila melanogaster OX=7227 GN=bigmax PE=2 SV=1
3	AFDB:Q2VPU4	0.256	0.091	2.283E-9	917	0.282	0.092	Q2VPU4.pdb.gz	MLXIP_MOUSE MLX-interacting protein OS=Mus musculus OX=10090 GN=Mlxip PE=1 SV=1
4	AFDB:Q9NP71	0.274	0.109	1.022E-8	852	0.258	0.090	Q9NP71.pdb.gz	MLXPL_HUMAN Carbohydrate-responsive element-binding protein OS=Homo sapiens OX=9606 GN=MLXIPL PE=1 SV=1
5	AFDB:A0A0C4DG26	0.287	0.133	9.097E-8	721	0.235	0.097	A0A0C4DG26.pdb.gz	A0A0C4DG26_HUMAN HCG18989, isoform CRA_h OS=Homo sapiens OX=9606 GN=MLXIPL PE=1 SV=1
6	AFDB:Q9VID4	0.255	0.079	1.408E-7	1119	0.232	0.062	Q9VID4.pdb.gz	Q9VID4_DROME LD38259p OS=Drosophila melanogaster OX=7227 GN=Mondo PE=2 SV=2
7	AFDB:P41846	0.226	0.077	1.512E-6	1009	0.232	0.068	P41846.pdb.gz	WBS14_CAEEL Protein WBSCR14 homolog OS=Caenorhabditis elegans OX=6239 GN=mml-1 PE=1 SV=2
8	AFDB:A0A0S2Z4U5	0.262	0.252	4.177E-4	310	0.168	0.161	A0A0S2Z4U5.pdb.gz	A0A0S2Z4U5_HUMAN Upstream transcription factor 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=USF1 PE=2 SV=1
9	AFDB:Q63665	0.253	0.224	4.733E-4	346	0.174	0.150	Q63665.pdb.gz	USF2_RAT Upstream stimulatory factor 2 OS=Rattus norvegicus OX=10116 GN=Usf2 PE=1 SV=2
10	AFDB:Q8WYA1	0.185	0.098	6.076E-4	636	0.124	0.058	Q8WYA1.pdb.gz	BMAL2_HUMAN Basic helix-loop-helix ARNT-like protein 2 OS=Homo sapiens OX=9606 GN=BMAL2 PE=1 SV=2
11	PDB:5mrcR	0.113	0.105	9.309E-1	331	0.104	0.094	5mrcR.pdb.gz	The structure of the yeast mitochondrial ribosome.
12	PDB:4wa6B	0.106	0.250	3.050	96	0.054	0.167	4wa6B.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
13	PDB:6hivDH	0.088	0.051	3.050	564	0.027	0.014	6hivDH.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
14	PDB:6nmiC	0.094	0.074	4.168	408	0.023	0.017	6nmiC.pdb.gz	The complete structure of the human TFIIH core complex.
15	PDB:7ungi	0.112	0.128	5.351	250	0.111	0.132	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
16	PDB:7akjA	0.134	0.047	5.696	1084	0.034	0.009	7akjA.pdb.gz
17	PDB:2ahzA	0.134	0.254	6.063	105	0.057	0.162	2ahzA.pdb.gz
18	PDB:7mqaLQ	0.075	0.037	6.063	830	0.067	0.024	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7qooH	0.135	0.181	6.870	210	0.104	0.148	7qooH.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
20	PDB:8h15C	0.107	0.049	6.870	962	0.047	0.015	8h15C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08609	0.0	523	298	0.956	0.956	MLX_MOUSE Max-like protein X OS=Mus musculus OX=10090 GN=Mlx PE=1 SV=1
2	Q9UH92	0.0	620	298	1.000	1.000	MLX_HUMAN Max-like protein X OS=Homo sapiens OX=9606 GN=MLX PE=1 SV=2
3	Q9VB47	3.27e-56	184	254	0.295	0.346	Q9VB47_DROME Bigmax OS=Drosophila melanogaster OX=7227 GN=bigmax PE=2 SV=1
4	Q9GQP6	9.72e-56	182	254	0.295	0.346	Q9GQP6_DROME BHLHZip transcription factor BIGMAX OS=Drosophila melanogaster OX=7227 GN=bigmax PE=2 SV=1
5	Q99MZ3	1.24e-22	100	864	0.208	0.072	MLXPL_MOUSE Carbohydrate-responsive element-binding protein OS=Mus musculus OX=10090 GN=Mlxipl PE=1 SV=1
6	Q8VIP2	3.51e-22	99.0	865	0.205	0.071	MLXPL_RAT Carbohydrate-responsive element-binding protein OS=Rattus norvegicus OX=10116 GN=Mlxipl PE=1 SV=1
7	Q9NP71	1.22e-21	97.1	852	0.205	0.072	MLXPL_HUMAN Carbohydrate-responsive element-binding protein OS=Homo sapiens OX=9606 GN=MLXIPL PE=1 SV=1
8	Q2VPU4	4.66e-21	95.5	917	0.181	0.059	MLXIP_MOUSE MLX-interacting protein OS=Mus musculus OX=10090 GN=Mlxip PE=1 SV=1
9	Q9HAP2	1.08e-19	91.7	919	0.185	0.060	MLXIP_HUMAN MLX-interacting protein OS=Homo sapiens OX=9606 GN=MLXIP PE=1 SV=2
10	A0A0C4DG26	2.24e-19	90.5	721	0.191	0.079	A0A0C4DG26_HUMAN HCG18989, isoform CRA_h OS=Homo sapiens OX=9606 GN=MLXIPL PE=1 SV=1
11	Q9BKE4	1.04e-16	82.4	836	0.211	0.075	Q9BKE4_DROME Mlx interactor gamma OS=Drosophila melanogaster OX=7227 GN=Mondo PE=2 SV=1
12	Q8INT6	1.23e-16	82.4	925	0.211	0.068	Q8INT6_DROME FI20159p1 OS=Drosophila melanogaster OX=7227 GN=Mondo PE=2 SV=1
13	Q9VID4	1.84e-16	82.0	1119	0.211	0.056	Q9VID4_DROME LD38259p OS=Drosophila melanogaster OX=7227 GN=Mondo PE=2 SV=2
14	Q9BKE5	3.41e-16	81.3	1062	0.185	0.052	Q9BKE5_DROME Mlx interactor beta OS=Drosophila melanogaster OX=7227 GN=Mondo PE=2 SV=1
15	Q9TZ70	8.46e-13	68.2	205	0.161	0.234	MXL2_CAEEL Max-like protein homolog 2 OS=Caenorhabditis elegans OX=6239 GN=mxl-2 PE=1 SV=1
16	P41846	2.75e-07	54.3	1009	0.131	0.039	WBS14_CAEEL Protein WBSCR14 homolog OS=Caenorhabditis elegans OX=6239 GN=mml-1 PE=1 SV=2
17	Q9Y5J3	2.22e-06	50.4	304	0.138	0.135	HEY1_HUMAN Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Homo sapiens OX=9606 GN=HEY1 PE=1 SV=1
18	P56720	4.88e-06	50.4	1134	0.138	0.036	SRBP1_RAT Sterol regulatory element-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Srebf1 PE=1 SV=3
19	A0A8I5ZYX7	7.33e-06	49.7	617	0.148	0.071	A0A8I5ZYX7_RAT Hes-related family bHLH transcription factor with YRPW motif 1 OS=Rattus norvegicus OX=10116 GN=Hey1 PE=4 SV=1
20	Q10186	9.35e-06	47.8	201	0.128	0.189	YAWC_SCHPO Uncharacterized bHLH domain-containing protein C3F10.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3F10.12c PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11795 DUF3322	61	15.1	Uncharacterized protein conserved in bacteria N-term (DUF3322)
2	PF00010 HLH	2.6e-11	54.6	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000246912

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312834	0.991	MLX-interacting protein
2	9606.ENSP00000320886	0.991	Carbohydrate-responsive element-binding protein
3	9606.ENSP00000337889	0.963	Max dimerization protein 4
4	9606.ENSP00000253792	0.918	ATP-citrate synthase
5	9606.ENSP00000174618	0.904	Max-binding protein MNT
6	9606.ENSP00000362824	0.826	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
7	9606.ENSP00000312649	0.802	Peroxisome proliferator-activated receptor gamma coactivator 1-beta
8	9606.ENSP00000386394	0.764	NIF3-like protein 1
9	9606.ENSP00000264444	0.732	Max dimerization protein 1
10	9606.ENSP00000462521	0.720	Thioredoxin-interacting protein
11	9606.ENSP00000363089	0.701	Toll-like receptor 4
12	9606.ENSP00000037243	0.678	Gamma-aminobutyric acid receptor-associated protein-like 2
13	9606.ENSP00000320794	0.667	Basic helix-loop-helix domain-containing protein USF3
14	9606.ENSP00000426033	0.664	Hairy and enhancer of split-related protein HELT
15	9606.ENSP00000339933	0.651	Pyruvate kinase PKLR
16	9606.ENSP00000384863	0.645	Exportin-1
17	9606.ENSP00000466799	0.643	Estradiol 17-beta-dehydrogenase 1
18	9606.ENSP00000240851	0.602	Protein TFG
19	9606.ENSP00000268042	0.584	Arrestin domain-containing protein 4
20	9606.ENSP00000378360	0.571	Triokinase/FMN cyclase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.997	DNA binding
GO:0043565	0.968	sequence-specific DNA binding
GO:0140110	0.951	transcription regulator activity
GO:0003700	0.937	DNA-binding transcription factor activity
GO:1990837	0.936	sequence-specific double-stranded DNA binding
GO:0000976	0.907	transcription cis-regulatory region binding
GO:0008134	0.825	transcription factor binding
GO:0046983	0.814	protein dimerization activity
GO:0042802	0.728	identical protein binding
GO:0140297	0.686	DNA-binding transcription factor binding
GO:0000981	0.524	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.465	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006355	0.987	regulation of DNA-templated transcription
GO:0048518	0.981	positive regulation of biological process
GO:0006357	0.960	regulation of transcription by RNA polymerase II
GO:0048522	0.928	positive regulation of cellular process
GO:0009893	0.918	positive regulation of metabolic process
GO:0009987	0.907	cellular process
GO:0048519	0.895	negative regulation of biological process
GO:0045935	0.886	positive regulation of nucleobase-containing compound metabolic process
GO:0009891	0.857	positive regulation of biosynthetic process
GO:0048523	0.854	negative regulation of cellular process
GO:0010604	0.851	positive regulation of macromolecule metabolic process
GO:0009892	0.815	negative regulation of metabolic process
GO:0010605	0.802	negative regulation of macromolecule metabolic process
GO:0031328	0.802	positive regulation of cellular biosynthetic process
GO:0051254	0.800	positive regulation of RNA metabolic process
GO:0051172	0.799	negative regulation of nitrogen compound metabolic process
GO:0031324	0.799	negative regulation of cellular metabolic process
GO:0010557	0.795	positive regulation of macromolecule biosynthetic process
GO:0000122	0.792	negative regulation of transcription by RNA polymerase II
GO:0045893	0.758	positive regulation of DNA-templated transcription
GO:0045944	0.421	positive regulation of transcription by RNA polymerase II
GO:0051179	0.320	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	1.000	nucleoplasm
GO:0005829	0.966	cytosol
GO:0012505	0.831	endomembrane system
GO:0016020	0.678	membrane
GO:0031090	0.512	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]