StarFunc result for job id Q9UHA4

User Input

>input (124 residues)
MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQG
SKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQV
VEVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88653	0.992	0.992	6.908E-23	124	0.976	0.976	O88653.pdb.gz	LTOR3_MOUSE Ragulator complex protein LAMTOR3 OS=Mus musculus OX=10090 GN=Lamtor3 PE=1 SV=1
2	PDB:5x6uA	0.959	0.959	6.455E-22	124	0.976	0.976	5x6uA.pdb.gz
3	AFDB:Q9VJD2	0.953	0.953	2.449E-15	124	0.444	0.444	Q9VJD2.pdb.gz	LTOR3_DROME Ragulator complex protein LAMTOR3 homolog OS=Drosophila melanogaster OX=7227 GN=Lamtor3 PE=1 SV=1
4	AFDB:Q9JHS3	0.762	0.757	2.710E-6	125	0.137	0.136	Q9JHS3.pdb.gz	LTOR2_MOUSE Ragulator complex protein LAMTOR2 OS=Mus musculus OX=10090 GN=Lamtor2 PE=1 SV=1
5	PDB:6b9xB	0.695	0.685	5.600E-6	126	0.137	0.135	6b9xB.pdb.gz
6	AFDB:Q9V8I2	0.724	0.719	1.560E-5	125	0.121	0.120	Q9V8I2.pdb.gz	LTOR2_DROME Ragulator complex protein LAMTOR2 homolog OS=Drosophila melanogaster OX=7227 GN=Lamtor2 PE=1 SV=1
7	AFDB:O50393	0.694	0.667	3.420E-5	130	0.153	0.146	O50393.pdb.gz	SPI_MYCTU Serine protease inhibitor Rv3364c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3364c PE=1 SV=1
8	AFDB:Q381D2	0.557	0.679	4.353E-5	98	0.097	0.122	Q381D2.pdb.gz	Q381D2_TRYB2 Dynein light chain roadblock OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8240 PE=3 SV=1
9	AFDB:Q9VQA6	0.579	0.714	5.887E-5	97	0.145	0.186	Q9VQA6.pdb.gz	Q9VQA6_DROME Dynein light chain roadblock OS=Drosophila melanogaster OX=7227 GN=robl22E PE=1 SV=1
10	PDB:3l9kA	0.559	0.707	1.216E-4	95	0.097	0.126	3l9kA.pdb.gz
11	PDB:3t1rC	0.729	0.673	1.216E-4	136	0.145	0.132	3t1rC.pdb.gz	Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
12	AFDB:Q8TF09	0.576	0.718	1.290E-4	96	0.097	0.125	Q8TF09.pdb.gz	DLRB2_HUMAN Dynein light chain roadblock-type 2 OS=Homo sapiens OX=9606 GN=DYNLRB2 PE=1 SV=1
13	AFDB:Q9SWQ6	0.594	0.686	1.546E-4	105	0.113	0.133	Q9SWQ6.pdb.gz	Q9SWQ6_CHLRE Dynein light chain roadblock OS=Chlamydomonas reinhardtii OX=3055 GN=LC7 PE=1 SV=1
14	AFDB:Q38D18	0.557	0.681	1.643E-4	98	0.097	0.122	Q38D18.pdb.gz	Q38D18_TRYB2 Dynein light chain roadblock OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4920 PE=3 SV=1
15	PDB:3ms6A	0.530	0.681	2.832E-4	91	0.081	0.110	3ms6A.pdb.gz
16	PDB:7kzmI	0.577	0.675	4.068E-4	103	0.137	0.165	7kzmI.pdb.gz	Structure of a microtubule-bound axonemal dynein.
17	PDB:1y4oA	0.520	0.601	5.179E-4	104	0.113	0.135	1y4oA.pdb.gz
18	PDB:6jwpJ	0.513	0.454	5.501E-4	144	0.177	0.153	6jwpJ.pdb.gz	Structural insights into the EGO-TC-mediated membrane tethering of the TORC1-regulatory Rag GTPases.
19	PDB:6izwB	0.648	0.570	6.207E-4	145	0.137	0.117	6izwB.pdb.gz	Allosteric regulation of a prokaryotic small Ras-like GTPase contributes to cell polarity oscillations in bacterial motility.
20	PDB:5y39D	0.507	0.608	8.916E-4	99	0.073	0.091	5y39D.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UHA4	8.25e-88	252	124	1.000	1.000	LTOR3_HUMAN Ragulator complex protein LAMTOR3 OS=Homo sapiens OX=9606 GN=LAMTOR3 PE=1 SV=1
2	O88653	5.85e-85	245	124	0.976	0.976	LTOR3_MOUSE Ragulator complex protein LAMTOR3 OS=Mus musculus OX=10090 GN=Lamtor3 PE=1 SV=1
3	Q5U204	2.78e-84	243	124	0.968	0.968	LTOR3_RAT Ragulator complex protein LAMTOR3 OS=Rattus norvegicus OX=10116 GN=Lamtor3 PE=2 SV=1
4	Q9VJD2	2.11e-37	125	124	0.444	0.444	LTOR3_DROME Ragulator complex protein LAMTOR3 homolog OS=Drosophila melanogaster OX=7227 GN=Lamtor3 PE=1 SV=1
5	Q54D21	0.97	30.8	289	0.113	0.048	Q54D21_DICDI Glucose/ribitol dehydrogenase family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0292574 PE=3 SV=1
6	Q86JE1	1.0	30.8	205	0.177	0.107	Y2130_DICDI Recoverin family protein DDB_G0272130 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0272130 PE=1 SV=1
7	P0A9A6	1.4	30.4	383	0.121	0.039	FTSZ_ECOLI Cell division protein FtsZ OS=Escherichia coli (strain K12) OX=83333 GN=ftsZ PE=1 SV=1
8	O45087	3.4	29.6	643	0.145	0.028	O45087_CAEEL WD_REPEATS_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dyci-1 PE=1 SV=1
9	P9WPR1	5.0	28.9	503	0.105	0.026	Y2897_MYCTU Uncharacterized protein Rv2897c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2897c PE=3 SV=1
10	Q9VKZ0	6.6	28.5	842	0.081	0.012	Q9VKZ0_DROME FI19405p1 OS=Drosophila melanogaster OX=7227 GN=GATAd PE=1 SV=2
11	Q95TF1	10.0	28.1	441	0.081	0.023	Q95TF1_DROME GH03570p OS=Drosophila melanogaster OX=7227 GN=GATAd PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08923 MAPKK1_Int	7.5e-47	169.4	Mitogen-activated protein kinase kinase 1 interacting

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 132908.ENSPVAP00000016672

Rank	PPI partner	STRING score	Description
1	132908.ENSPVAP00000009736	0.999	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 2
2	132908.ENSPVAP00000011296	0.999	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 4
3	132908.ENSPVAP00000006786	0.998	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 5
4	132908.ENSPVAP00000000995	0.996	Ras-related GTP binding D
5	132908.ENSPVAP00000002311	0.996	Solute carrier family 38, member 9
6	132908.ENSPVAP00000009610	0.996	Ras-related GTP binding B
7	132908.ENSPVAP00000014899	0.996	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 1
8	132908.ENSPVAP00000011635	0.991	annotation not available
9	132908.ENSPVAP00000008016	0.989	Regulatory associated protein of MTOR, complex 1
10	132908.ENSPVAP00000000060	0.875	Mitogen-activated protein kinase kinase 1
11	132908.ENSPVAP00000002530	0.875	Mitogen-activated protein kinase kinase 2
12	132908.ENSPVAP00000002703	0.866	annotation not available
13	132908.ENSPVAP00000011041	0.832	Folliculin interacting protein 2
14	132908.ENSPVAP00000014304	0.827	Interleukin 4
15	132908.ENSPVAP00000005818	0.823	ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A
16	132908.ENSPVAP00000009982	0.812	ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2
17	132908.ENSPVAP00000002742	0.810	ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B1
18	132908.ENSPVAP00000009950	0.783	Mitogen-activated protein kinase 3
19	132908.ENSPVAP00000012866	0.783	Mitogen-activated protein kinase 1
20	132908.ENSPVAP00000004406	0.766	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140677	0.994	molecular function activator activity
GO:0030234	0.994	enzyme regulator activity
GO:0030695	0.635	GTPase regulator activity
GO:0140678	0.561	molecular function inhibitor activity
GO:0005085	0.554	guanyl-nucleotide exchange factor activity
GO:0060090	0.540	molecular adaptor activity
GO:0008047	0.531	enzyme activator activity
GO:0019209	0.500	kinase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.998	regulation of cellular process
GO:0008104	0.994	protein localization
GO:0048522	0.990	positive regulation of cellular process
GO:0032006	0.990	regulation of TOR signaling
GO:0051716	0.987	cellular response to stimulus
GO:0048584	0.971	positive regulation of response to stimulus
GO:0023056	0.965	positive regulation of signaling
GO:0010647	0.965	positive regulation of cell communication
GO:1901698	0.960	response to nitrogen compound
GO:0070887	0.958	cellular response to chemical stimulus
GO:0009967	0.958	positive regulation of signal transduction
GO:0010033	0.951	response to organic substance
GO:0032008	0.948	positive regulation of TOR signaling
GO:0001101	0.946	response to acid chemical
GO:1901700	0.943	response to oxygen-containing compound
GO:0071417	0.936	cellular response to organonitrogen compound
GO:0071229	0.929	cellular response to acid chemical
GO:0043200	0.928	response to amino acid
GO:1901701	0.907	cellular response to oxygen-containing compound
GO:0071230	0.818	cellular response to amino acid stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005768	0.998	endosome
GO:0032991	0.997	protein-containing complex
GO:0031090	0.980	organelle membrane
GO:0005764	0.965	lysosome
GO:0005829	0.963	cytosol
GO:0005886	0.962	plasma membrane
GO:0005765	0.957	lysosomal membrane
GO:0005576	0.933	extracellular region
GO:0140535	0.897	intracellular protein-containing complex
GO:0070062	0.841	extracellular exosome
GO:0099503	0.697	secretory vesicle
GO:0030659	0.696	cytoplasmic vesicle membrane
GO:0030141	0.694	secretory granule
GO:0070161	0.625	anchoring junction
GO:0098796	0.560	membrane protein complex
GO:0010008	0.552	endosome membrane
GO:0070820	0.548	tertiary granule
GO:0030667	0.535	secretory granule membrane
GO:0032045	0.531	guanyl-nucleotide exchange factor complex
GO:0070013	0.495	intracellular organelle lumen
GO:0070821	0.490	tertiary granule membrane
GO:0030055	0.478	cell-substrate junction
GO:0005770	0.466	late endosome
GO:0005925	0.458	focal adhesion
GO:0042581	0.442	specific granule
GO:0035579	0.432	specific granule membrane
GO:0031902	0.378	late endosome membrane
GO:0101002	0.356	ficolin-1-rich granule
GO:0101003	0.347	ficolin-1-rich granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]