StarFunc result for job id Q9UHA7

User Input

>input (158 residues)
MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRG
NPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFES
VAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UHA7	1.000	1.000	1.642E-30	158	1.000	1.000	Q9UHA7.pdb.gz	IL36A_HUMAN Interleukin-36 alpha OS=Homo sapiens OX=9606 GN=IL36A PE=1 SV=1
2	PDB:6hpiA	0.811	0.811	6.670E-22	158	1.000	1.000	6hpiA.pdb.gz
3	PDB:4izeA	0.920	0.956	2.972E-20	152	0.551	0.572	4izeA.pdb.gz
4	AFDB:Q9NZH8	0.953	0.892	4.483E-20	169	0.551	0.515	Q9NZH8.pdb.gz	IL36G_HUMAN Interleukin-36 gamma OS=Homo sapiens OX=9606 GN=IL36G PE=1 SV=1
5	AFDB:Q9JLA2	0.954	0.943	9.285E-20	160	0.538	0.531	Q9JLA2.pdb.gz	IL36A_MOUSE Interleukin-36 alpha OS=Mus musculus OX=10090 GN=Il36a PE=1 SV=1
6	AFDB:Q8R460	0.929	0.895	1.269E-19	164	0.437	0.421	Q8R460.pdb.gz	IL36G_MOUSE Interleukin-36 gamma OS=Mus musculus OX=10090 GN=Il36g PE=2 SV=1
7	AFDB:Q9D6Z6	0.943	0.819	1.112E-17	183	0.405	0.350	Q9D6Z6.pdb.gz	IL36B_MOUSE Interleukin-36 beta OS=Mus musculus OX=10090 GN=Il36b PE=2 SV=1
8	AFDB:Q9NZH6	0.887	0.653	3.912E-14	218	0.329	0.239	Q9NZH6.pdb.gz	IL37_HUMAN Interleukin-37 OS=Homo sapiens OX=9606 GN=IL37 PE=1 SV=1
9	AFDB:Q9QYY1	0.847	0.857	1.036E-12	156	0.297	0.301	Q9QYY1.pdb.gz	I36RA_MOUSE Interleukin-36 receptor antagonist protein OS=Mus musculus OX=10090 GN=IL36RN PE=1 SV=2
10	PDB:1md6A	0.845	0.866	3.446E-12	154	0.297	0.305	1md6A.pdb.gz
11	AFDB:M4WG34	0.866	0.526	4.934E-12	266	0.297	0.177	M4WG34.pdb.gz	M4WG34_SHEEP Multifunctional fusion protein OS=Ovis aries OX=9940 GN=IL1b PE=2 SV=2
12	AFDB:P25086	0.821	0.734	4.934E-12	178	0.310	0.275	P25086.pdb.gz	IL1RA_RAT Interleukin-1 receptor antagonist protein OS=Rattus norvegicus OX=10116 GN=Il1rn PE=2 SV=1
13	AFDB:P25085	0.810	0.722	6.741E-12	178	0.304	0.270	P25085.pdb.gz	IL1RA_MOUSE Interleukin-1 receptor antagonist protein OS=Mus musculus OX=10090 GN=Il1rn PE=2 SV=1
14	PDB:5bowA	0.833	0.869	9.258E-12	151	0.266	0.278	5bowA.pdb.gz
15	PDB:1irpA	0.716	0.736	1.551E-7	153	0.278	0.288	1irpA.pdb.gz
16	PDB:4qd2C	0.623	0.364	6.721E-4	286	0.095	0.052	4qd2C.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
17	PDB:4a7zA	0.645	0.135	7.856E-4	881	0.120	0.022	4a7zA.pdb.gz	Crystal Structure of Bifunctional Aldos-2-Ulose Dehydratase/Isomerase from Phanerochaete Chrysosporium with the Reaction Intermediate Ascopyrone M.
18	PDB:6uqkA	0.557	0.059	8.717E-4	2054	0.076	0.006	6uqkA.pdb.gz	Cryo-EM structure of human type-3 inositol triphosphate receptor reveals the presence of a self-binding peptide that acts as an antagonist.
19	PDB:3nbcA	0.612	0.648	9.673E-4	148	0.114	0.122	3nbcA.pdb.gz	Bivalent carbohydrate binding is required for biological activity of Clitocybe nebularis lectin (CNL), the N,N'-diacetyllactosediamine (GalNAc beta 1-4GlcNAc, LacdiNAc)-specific lectin from basidiomycete C. nebularis
20	PDB:4qd2B	0.590	0.643	1.191E-3	143	0.108	0.119	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UHA7	6.81e-118	331	158	1.000	1.000	IL36A_HUMAN Interleukin-36 alpha OS=Homo sapiens OX=9606 GN=IL36A PE=1 SV=1
2	Q9NZH8	2.45e-61	188	169	0.557	0.521	IL36G_HUMAN Interleukin-36 gamma OS=Homo sapiens OX=9606 GN=IL36G PE=1 SV=1
3	Q9JLA2	3.10e-61	188	160	0.538	0.531	IL36A_MOUSE Interleukin-36 alpha OS=Mus musculus OX=10090 GN=Il36a PE=1 SV=1
4	Q8R460	1.06e-48	156	164	0.437	0.421	IL36G_MOUSE Interleukin-36 gamma OS=Mus musculus OX=10090 GN=Il36g PE=2 SV=1
5	Q9D6Z6	5.74e-40	134	183	0.405	0.350	IL36B_MOUSE Interleukin-36 beta OS=Mus musculus OX=10090 GN=Il36b PE=2 SV=1
6	Q9NZH6	1.84e-20	85.9	218	0.329	0.239	IL37_HUMAN Interleukin-37 OS=Homo sapiens OX=9606 GN=IL37 PE=1 SV=1
7	Q9NZH7	1.76e-19	82.0	164	0.234	0.226	IL36B_HUMAN Interleukin-36 beta OS=Homo sapiens OX=9606 GN=IL36B PE=1 SV=1
8	P25085	2.25e-17	76.6	178	0.304	0.270	IL1RA_MOUSE Interleukin-1 receptor antagonist protein OS=Mus musculus OX=10090 GN=Il1rn PE=2 SV=1
9	P25086	2.32e-17	76.6	178	0.297	0.264	IL1RA_RAT Interleukin-1 receptor antagonist protein OS=Rattus norvegicus OX=10116 GN=Il1rn PE=2 SV=1
10	Q9UBH0	2.14e-16	73.6	155	0.272	0.277	I36RA_HUMAN Interleukin-36 receptor antagonist protein OS=Homo sapiens OX=9606 GN=IL36RN PE=1 SV=1
11	A3DTN2	8.04e-16	74.3	267	0.329	0.195	A3DTN2_ANAPL Interleukin-1 OS=Anas platyrhynchos OX=8839 PE=2 SV=1
12	O73909	8.04e-16	74.3	267	0.329	0.195	O73909_CHICK Interleukin-1 OS=Gallus gallus OX=9031 GN=il-1beta PE=1 SV=1
13	E9LHC8	8.29e-16	74.3	267	0.329	0.195	E9LHC8_CHICK Interleukin-1 OS=Gallus gallus OX=9031 PE=2 SV=1
14	A3DTN3	1.11e-15	73.9	267	0.329	0.195	A3DTN3_9AVES Interleukin-1 OS=Anser anser OX=8843 PE=2 SV=1
15	F4ZWC1	1.62e-15	73.6	267	0.329	0.195	F4ZWC1_CHICK Interleukin-1 OS=Gallus gallus OX=9031 PE=2 SV=1
16	Q8WWZ1	2.86e-15	70.5	152	0.253	0.263	IL1FA_HUMAN Interleukin-1 family member 10 OS=Homo sapiens OX=9606 GN=IL1F10 PE=1 SV=1
17	P18510	3.22e-15	70.9	177	0.285	0.254	IL1RA_HUMAN Interleukin-1 receptor antagonist protein OS=Homo sapiens OX=9606 GN=IL1RN PE=1 SV=1
18	P21621	5.74e-15	72.0	266	0.253	0.150	IL1B_SHEEP Interleukin-1 beta OS=Ovis aries OX=9940 GN=IL1B PE=2 SV=2
19	M4WG34	6.29e-15	72.0	266	0.253	0.150	M4WG34_SHEEP Multifunctional fusion protein OS=Ovis aries OX=9940 GN=IL1b PE=2 SV=2
20	A3DTN5	6.43e-15	72.0	267	0.323	0.191	A3DTN5_MELGA Interleukin-1 OS=Meleagris gallopavo OX=9103 GN=IL1RN PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00340 IL1	4.5e-16	70.0	Interleukin-1 / 18

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000259211

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264257	0.957	Interleukin-1 receptor-like 2
2	9606.ENSP00000376896	0.926	Interleukin-36 receptor antagonist protein
3	9606.ENSP00000376893	0.918	Interleukin-1 family member 10
4	9606.ENSP00000314807	0.850	Interleukin 1 receptor accessory protein
5	9606.ENSP00000385675	0.754	Interleukin-6
6	9606.ENSP00000398698	0.738	Tumor necrosis factor
7	9606.ENSP00000259213	0.733	Interleukin-36 beta
8	9606.ENSP00000259205	0.699	Interleukin-36 gamma
9	9606.ENSP00000263339	0.668	Interleukin-1 alpha
10	9606.ENSP00000433623	0.602	TNF receptor-associated factor 6
11	9606.ENSP00000255030	0.580	C-reactive protein
12	9606.ENSP00000226730	0.567	Interleukin-2
13	9606.ENSP00000412237	0.559	Interleukin-10
14	9606.ENSP00000386380	0.557	Interleukin-1 receptor type 1
15	9606.ENSP00000280357	0.555	Interleukin-18
16	9606.ENSP00000306512	0.554	Interleukin-8
17	9606.ENSP00000356438	0.548	Prostaglandin G/H synthase 2
18	9606.ENSP00000229135	0.543	Interferon gamma
19	9606.ENSP00000264832	0.507	Intercellular adhesion molecule 1
20	9606.ENSP00000363089	0.507	Toll-like receptor 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005125	1.000	cytokine activity
GO:0005126	0.318	cytokine receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019222	0.985	regulation of metabolic process
GO:0010468	0.983	regulation of gene expression
GO:0051239	0.979	regulation of multicellular organismal process
GO:0048518	0.979	positive regulation of biological process
GO:0010604	0.967	positive regulation of macromolecule metabolic process
GO:0001817	0.962	regulation of cytokine production
GO:0050794	0.889	regulation of cellular process
GO:0001819	0.876	positive regulation of cytokine production
GO:0009987	0.872	cellular process
GO:0050896	0.866	response to stimulus
GO:0007154	0.794	cell communication
GO:0023052	0.793	signaling
GO:0032675	0.770	regulation of interleukin-6 production
GO:0032755	0.743	positive regulation of interleukin-6 production
GO:0006950	0.563	response to stress
GO:0048519	0.533	negative regulation of biological process
GO:0006952	0.518	defense response
GO:0002376	0.511	immune system process
GO:0048522	0.505	positive regulation of cellular process
GO:0051716	0.497	cellular response to stimulus
GO:0006955	0.470	immune response
GO:0048583	0.433	regulation of response to stimulus
GO:0048523	0.390	negative regulation of cellular process
GO:0032501	0.351	multicellular organismal process
GO:0042221	0.345	response to chemical
GO:0002684	0.325	positive regulation of immune system process
GO:0080090	0.320	regulation of primary metabolic process
GO:0051171	0.320	regulation of nitrogen compound metabolic process
GO:0031323	0.320	regulation of cellular metabolic process
GO:0009892	0.305	negative regulation of metabolic process
GO:0050793	0.304	regulation of developmental process
GO:0023051	0.302	regulation of signaling
GO:0010646	0.302	regulation of cell communication
GO:0009605	0.301	response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005615	0.701	extracellular space
GO:0005622	0.687	intracellular anatomical structure
GO:0071944	0.433	cell periphery
GO:0043227	0.389	membrane-bounded organelle
GO:0005737	0.350	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]