StarFunc result for job id Q9UHB6

User Input

>input (759 residues)
MESSPFNRRQWTSLSLRVTAKELSLVNKNKSSAIVEIFSKYQKAAEETNMEKKRSNTENL
SQHFRKGTLTVLKKKWENPGLGAESHTDSLRNSSTEIRHRADHPPAEVTSHAASGAKADQ
EEQIHPRSRLRSPPEALVQGRYPHIKDGEDLKDHSTESKKMENCLGESRHEVEKSEISEN
TDASGKIEKYNVPLNRLKMMFEKGEPTQTKILRAQSRSASGRKISENSYSLDDLEIGPGQ
LSSSTFDSEKNESRRNLELPRLSETSIKDRMAKYQAAVSKQSSSTNYTNELKASGGEIKI
HKMEQKENVPPGPEVCITHQEGEKISANENSLAVRSTPAEDDSRDSQVKSEVQQPVHPKP
LSPDSRASSLSESSPPKAMKKFQAPARETCVECQKTVYPMERLLANQQVFHISCFRCSYC
NNKLSLGTYASLHGRIYCKPHFNQLFKSKGNYDEGFGHRPHKDLWASKNENEEILERPAQ
LANARETPHSPGVEDAPIAKVGVLAASMEAKASSQQEKEDKPAETKKLRIAWPPPTELGS
SGSALEEGIKMSKPKWPPEDEISKPEVPEDVDLDLKKLRRSSSLKERSRPFTVAASFQST
SVKSPKTVSPPIRKGWSMSEQSEESVGGRVAERKQVENAKASKKNGNVGKTTWQNKESKG
ETGKRSKEGHSLEMENENLVENGADSDEDDNSFLKQQSPQEPKSLNWSSFVDNTFAEEFT
TQNQKSQDVELWEGEVVKELSVEEQIKRNRYYDEDEDEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UHB6	1.000	1.000	0.000	759	1.000	1.000	Q9UHB6.pdb.gz	LIMA1_HUMAN LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1
2	AFDB:Q9ERG0	0.226	0.228	1.376E-79	753	0.760	0.766	Q9ERG0.pdb.gz	LIMA1_MOUSE LIM domain and actin-binding protein 1 OS=Mus musculus OX=10090 GN=Lima1 PE=1 SV=3
3	PDB:1b8tA	0.082	0.306	2.418E-5	192	0.040	0.156	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
4	PDB:1imlA	0.079	0.658	6.556E-5	76	0.028	0.276	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
5	PDB:4kfzB	0.078	0.360	2.030E-4	148	0.021	0.108	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
6	AFDB:A0A1D8PGH4	0.055	0.022	3.914E-4	2624	0.167	0.048	A0A1D8PGH4.pdb.gz	A0A1D8PGH4_CANAL 1-phosphatidylinositol-3-phosphate 5-kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FAB1 PE=4 SV=1
7	AFDB:Q9VF00	0.068	0.069	5.457E-4	746	0.136	0.138	Q9VF00.pdb.gz	Q9VF00_DROME GATAe, isoform A OS=Drosophila melanogaster OX=7227 GN=GATAe PE=2 SV=2
8	AFDB:Q3U0P1	0.047	0.037	4.582E-3	1104	0.154	0.106	Q3U0P1.pdb.gz	PALB2_MOUSE Partner and localizer of BRCA2 OS=Mus musculus OX=10090 GN=Palb2 PE=1 SV=2
9	AFDB:Q91Z96	0.061	0.046	4.111E-2	1138	0.145	0.097	Q91Z96.pdb.gz	BMP2K_MOUSE BMP-2-inducible protein kinase OS=Mus musculus OX=10090 GN=Bmp2k PE=1 SV=1
10	AFDB:Q8NDX5	0.049	0.040	6.548E-2	983	0.146	0.113	Q8NDX5.pdb.gz	PHC3_HUMAN Polyhomeotic-like protein 3 OS=Homo sapiens OX=9606 GN=PHC3 PE=1 SV=1
11	AFDB:Q8MSN5	0.052	0.046	1.191E-1	893	0.121	0.103	Q8MSN5.pdb.gz	Q8MSN5_DROME AT15637p OS=Drosophila melanogaster OX=7227 GN=CG10543 PE=2 SV=1
12	AFDB:Q8K298	0.060	0.046	2.028E-1	1121	0.120	0.081	Q8K298.pdb.gz	ANLN_MOUSE Anillin OS=Mus musculus OX=10090 GN=Anln PE=1 SV=2
13	AFDB:Q6FWW9	0.053	0.044	2.167E-1	823	0.152	0.140	Q6FWW9.pdb.gz	Q6FWW9_CANGA Candida glabrata strain CBS138 chromosome C complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=GLN3 PE=4 SV=1
14	PDB:7uhyD	0.060	0.145	2.336E-1	288	0.018	0.049	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
15	PDB:7uhyA	0.055	0.055	4.541E-1	771	0.016	0.016	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
16	PDB:7uhyC	0.064	0.082	5.544E-1	578	0.014	0.019	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
17	PDB:6ip52Q	0.040	0.158	1.503	124	0.017	0.105	6ip52Q.pdb.gz	HCV IRES Captures an Actively Translating 80S Ribosome.
18	PDB:7zsb4	0.046	0.102	1.606	306	0.011	0.026	7zsb4.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
19	PDB:7rroT	0.035	0.045	1.835	452	0.017	0.029	7rroT.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
20	PDB:2m1sA	0.053	0.251	1.961	99	0.026	0.202	2m1sA.pdb.gz	Structural characterization of the Z RING-eIF4E complex reveals a distinct mode of control for eIF4E

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8VQE1	0.0	1227	598	0.788	1.000	F8VQE1_HUMAN LIM domain and actin binding 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1
2	F8VS07	0.0	940	456	0.601	1.000	F8VS07_HUMAN LIM domain and actin binding 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1
3	Q9ERG0	0.0	1158	753	0.762	0.768	LIMA1_MOUSE LIM domain and actin-binding protein 1 OS=Mus musculus OX=10090 GN=Lima1 PE=1 SV=3
4	Q9UHB6	0.0	1563	759	1.000	1.000	LIMA1_HUMAN LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1
5	Q4U4S6	1.68e-48	188	3784	0.121	0.024	XIRP2_MOUSE Xin actin-binding repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Xirp2 PE=1 SV=1
6	A0A140VJN0	1.95e-36	135	127	0.078	0.465	A0A140VJN0_HUMAN Testicular tissue protein Li 106 OS=Homo sapiens OX=9606 PE=2 SV=1
7	Q9BT23	1.95e-36	135	127	0.078	0.465	LIMD2_HUMAN LIM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=LIMD2 PE=1 SV=1
8	J3QQM5	4.21e-33	125	109	0.075	0.523	J3QQM5_HUMAN LIM domain containing 2 (Fragment) OS=Homo sapiens OX=9606 GN=LIMD2 PE=1 SV=1
9	Q7F9R9	8.56e-17	81.6	201	0.053	0.199	PLI2B_ORYSJ LIM domain-containing protein PLIM2b OS=Oryza sativa subsp. japonica OX=39947 GN=PLIM2B PE=1 SV=1
10	O80839	1.00e-16	82.0	226	0.051	0.173	PLI2A_ARATH LIM domain-containing protein PLIM2a OS=Arabidopsis thaliana OX=3702 GN=PLIM2A PE=1 SV=1
11	O04193	2.31e-16	80.5	200	0.042	0.160	WLI2A_ARATH LIM domain-containing protein WLIM2a OS=Arabidopsis thaliana OX=3702 GN=WLIN2A PE=1 SV=1
12	Q9M047	3.25e-16	80.1	199	0.042	0.161	WLI2B_ARATH LIM domain-containing protein WLIM2b OS=Arabidopsis thaliana OX=3702 GN=WLIM2B PE=1 SV=1
13	Q94JX5	6.99e-16	79.0	190	0.042	0.168	WLIM1_ARATH LIM domain-containing protein WLIM1 OS=Arabidopsis thaliana OX=3702 GN=WLIM1 PE=1 SV=1
14	Q500W4	7.68e-16	79.3	213	0.042	0.150	PLI2C_ARATH LIM domain-containing protein PLIM2c OS=Arabidopsis thaliana OX=3702 GN=PLIM2C PE=1 SV=1
15	Q1ECF5	5.83e-15	76.6	205	0.042	0.156	PLI2B_ARATH LIM domain-containing protein PLIM2b OS=Arabidopsis thaliana OX=3702 GN=PLIM2B PE=1 SV=1
16	Q8BML1	1.46e-12	73.9	1951	0.049	0.019	MICA2_MOUSE [F-actin]-monooxygenase MICAL2 OS=Mus musculus OX=10090 GN=Mical2 PE=1 SV=2
17	Q7RTP6	2.40e-12	73.6	2002	0.040	0.015	MICA3_HUMAN [F-actin]-monooxygenase MICAL3 OS=Homo sapiens OX=9606 GN=MICAL3 PE=1 SV=2
18	F1RA39	2.44e-12	73.2	1679	0.055	0.025	MCA2B_DANRE [F-actin]-monooxygenase mical2b OS=Danio rerio OX=7955 GN=mical2b PE=2 SV=3
19	Q9BIW4	2.38e-11	65.9	198	0.033	0.126	LIMD_DICDI LIM domain-containing protein D OS=Dictyostelium discoideum OX=44689 GN=limD PE=2 SV=1
20	O94851	5.70e-11	68.9	1957	0.038	0.015	MICA2_HUMAN [F-actin]-monooxygenase MICAL2 OS=Homo sapiens OX=9606 GN=MICAL2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00412 LIM	2.6e-08	45.3	LIM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378400

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344456	0.978	Catenin beta-1
2	9606.ENSP00000304669	0.976	Catenin alpha-1
3	9606.ENSP00000261769	0.970	Cadherin-1
4	9606.ENSP00000382004	0.957	Catenin delta-1
5	9606.ENSP00000358596	0.811	Dual specificity protein phosphatase 5
6	9606.ENSP00000211998	0.760	Vinculin
7	9606.ENSP00000027335	0.685	Cadherin-17
8	9606.ENSP00000450832	0.653	Signal-induced proliferation-associated 1-like protein 1
9	9606.ENSP00000333938	0.651	Nexilin
10	9606.ENSP00000392316	0.612	Interferon related developmental regulator 2
11	9606.ENSP00000349960	0.605	Actin, cytoplasmic 1
12	9606.ENSP00000267257	0.602	Paxillin
13	9606.ENSP00000326759	0.580	Leucine-rich repeats and immunoglobulin-like domains protein 3
14	9606.ENSP00000375960	0.574	Afadin
15	9606.ENSP00000400175	0.574	Transforming protein RhoA
16	9606.ENSP00000350937	0.572	Testin
17	9606.ENSP00000297282	0.569	Solute carrier family 13 member 4
18	9606.ENSP00000258739	0.568	ER lumen protein-retaining receptor 2
19	9606.ENSP00000348128	0.552	Supervillin
20	9606.ENSP00000479134	0.543	Formin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051015	1.000	actin filament binding
GO:0045296	0.999	cadherin binding
GO:0003785	0.995	actin monomer binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0016043	0.982	cellular component organization
GO:0051128	0.958	regulation of cellular component organization
GO:0007010	0.950	cytoskeleton organization
GO:0022607	0.946	cellular component assembly
GO:0048523	0.945	negative regulation of cellular process
GO:0120036	0.929	plasma membrane bounded cell projection organization
GO:0030029	0.863	actin filament-based process
GO:0032970	0.862	regulation of actin filament-based process
GO:0051493	0.818	regulation of cytoskeleton organization
GO:1902903	0.796	regulation of supramolecular fiber organization
GO:0032956	0.796	regulation of actin cytoskeleton organization
GO:0065008	0.757	regulation of biological quality
GO:0110053	0.723	regulation of actin filament organization
GO:0051129	0.647	negative regulation of cellular component organization
GO:0097435	0.637	supramolecular fiber organization
GO:1901879	0.603	regulation of protein depolymerization
GO:0008064	0.591	regulation of actin polymerization or depolymerization
GO:0030834	0.540	regulation of actin filament depolymerization
GO:0030036	0.512	actin cytoskeleton organization
GO:0051179	0.453	localization
GO:0043242	0.431	negative regulation of protein-containing complex disassembly
GO:0048518	0.378	positive regulation of biological process
GO:0007015	0.370	actin filament organization
GO:0032501	0.344	multicellular organismal process
GO:0051494	0.332	negative regulation of cytoskeleton organization
GO:0048522	0.325	positive regulation of cellular process
GO:1902904	0.323	negative regulation of supramolecular fiber organization
GO:0061572	0.319	actin filament bundle organization
GO:0050896	0.314	response to stimulus
GO:0051017	0.306	actin filament bundle assembly
GO:0030835	0.300	negative regulation of actin filament depolymerization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0015629	0.999	actin cytoskeleton
GO:0005829	0.998	cytosol
GO:0070161	0.996	anchoring junction
GO:0005925	0.994	focal adhesion
GO:0098590	0.887	plasma membrane region
GO:0043227	0.802	membrane-bounded organelle
GO:0043231	0.790	intracellular membrane-bounded organelle
GO:0031982	0.418	vesicle
GO:0032154	0.386	cleavage furrow
GO:0120025	0.336	plasma membrane bounded cell projection
GO:0001725	0.327	stress fiber
GO:0070062	0.325	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]