StarFunc result for job id Q9UHB7

User Input

>input (1163 residues)
MNREDRNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQSMLGNYD
EMKDFIGDRSIPKLVAIPKPTVPPSADEKSNPNFFEQRHGGSHQSSKWTPVGPAPSTSQS
QKRSSGLQSGHSSQRTSAGSSSGTNSSGQRHDRESYNNSGSSSRKKGQHGSEHSKSRSSS
PGKPQAVSSLNSSHSRSHGNDHHSKEHQRSKSPRDPDANWDSPSRVPFSSGQHSTQSFPP
SLMSKSNSMLQKPTAYVRPMDGQESMEPKLSSEHYSSQSHGNSMTELKPSSKAHLTKLKI
PSQPLDASASGDVSCVDEILKEMTHSWPPPLTAIHTPCKTEPSKFPFPTKESQQSNFGTG
EQKRYNPSKTSNGHQSKSMLKDDLKLSSSEDSDGEQDCDKTMPRSTPGSNSEPSHHNSEG
ADNSRDDSSSHSGSESSSGSDSESESSSSDSEANEPSQSASPEPEPPPTNKWQLDNWLNK
VNPHKVSPASSVDSNIPSSQGYKKEGREQGTGNSYTDTSGPKETSSATPGRDSKTIQKGS
ESGRGRQKSPAQSDSTTQRRTVGKKQPKKAEKAAAEEPRGGLKIESETPVDLASSMPSSR
HKAATKGSRKPNIKKESKSSPRPTAEKKKYKSTSKSSQKSREIIETDTSSSDSDESESLP
PSSQTPKYPESNRTPVKPSSVEEEDSFFRQRMFSPMEEKELLSPLSEPDDRYPLIVKIDL
NLLTRIPGKPYKETEPPKGEKKNVPEKHTREAQKQASEKVSNKGKRKHKNEDDNRASESK
KPKTEDKNSAGHKPSSNRESSKQSAAKEKDLLPSPAGPVPSKDPKTEHGSRKRTISQSSS
LKSSSNSNKETSGSSKNSSSTSKQKKTEGKTSSSSKEVKEKAPSSSSNCPPSAPTLDSSK
PRRTKLVFDDRNYSADHYLQEAKKLKHNADALSDRFEKAVYYLDAVVSFIECGNALEKNA
QESKSPFPMYSETVDLIKYTMKLKNYLAPDATAADKRLTVLCLRCESLLYLRLFKLKKEN
ALKYSKTLTEHLKNSYNNSQAPSPGLGSKAVGMPSPVSPKLSPGNSGNYSSGASSASASG
SSVTIPQKIHQMAASYVQVTSNFLYATEIWDQAEQLSKEQKEFFAELDKVMGPLIFNASI
MTDLVRYTRQGLHWLRQDAKLIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UHB7	1.000	1.000	0.000	1163	1.000	1.000	Q9UHB7.pdb.gz	AFF4_HUMAN AF4/FMR2 family member 4 OS=Homo sapiens OX=9606 GN=AFF4 PE=1 SV=1
2	AFDB:P51825	0.234	0.226	4.355E-42	1210	0.398	0.383	P51825.pdb.gz	AFF1_HUMAN AF4/FMR2 family member 1 OS=Homo sapiens OX=9606 GN=AFF1 PE=1 SV=1
3	AFDB:P51826	0.244	0.233	1.601E-41	1226	0.383	0.364	P51826.pdb.gz	AFF3_HUMAN AF4/FMR2 family member 3 OS=Homo sapiens OX=9606 GN=AFF3 PE=1 SV=3
4	AFDB:P51816	0.228	0.204	2.298E-39	1311	0.402	0.356	P51816.pdb.gz	AFF2_HUMAN AF4/FMR2 family member 2 OS=Homo sapiens OX=9606 GN=AFF2 PE=1 SV=4
5	AFDB:O88573	0.225	0.216	1.303E-38	1216	0.365	0.350	O88573.pdb.gz	AFF1_MOUSE AF4/FMR2 family member 1 OS=Mus musculus OX=10090 GN=Aff1 PE=1 SV=2
6	AFDB:Q9VQI9	0.183	0.131	5.061E-13	1673	0.182	0.127	Q9VQI9.pdb.gz	AFFL_DROME AF4/FMR2 family member lilli OS=Drosophila melanogaster OX=7227 GN=lilli PE=1 SV=2
7	AFDB:F4IZK5	0.154	0.129	1.342E-7	1403	0.159	0.132	F4IZK5.pdb.gz	F4IZK5_ARATH CW-type Zinc Finger OS=Arabidopsis thaliana OX=3702 GN=At3g62900 PE=1 SV=2
8	AFDB:Q0DIQ5	0.141	0.111	3.196E-7	1510	0.172	0.132	Q0DIQ5.pdb.gz	CWZF5_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 5 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF5 PE=1 SV=1
9	AFDB:F4HWC3	0.063	0.056	2.197E-2	1364	0.134	0.114	F4HWC3.pdb.gz	F4HWC3_ARATH Calponin-like domain protein OS=Arabidopsis thaliana OX=3702 GN=At1g20970 PE=1 SV=1
10	AFDB:Q9VCH1	0.066	0.042	8.078E-2	2072	0.161	0.090	Q9VCH1.pdb.gz	Q9VCH1_DROME Eukaryotic translation initiation factor 4G2, isoform A OS=Drosophila melanogaster OX=7227 GN=eIF4G2 PE=1 SV=2
11	PDB:4im0A	0.045	0.070	2.145	619	0.019	0.036	4im0A.pdb.gz	Structure and ubiquitination-dependent activation of TANK-binding kinase 1.
12	PDB:1qoyA	0.054	0.154	2.864	303	0.017	0.066	1qoyA.pdb.gz
13	PDB:7np7D1	0.077	0.156	2.864	485	0.020	0.047	7np7D1.pdb.gz
14	PDB:4zdrA	0.075	0.227	3.006	243	0.034	0.165	4zdrA.pdb.gz	Structure of the 14-3-3 zeta-LKB1 fusion protein provides insight into a novel ligand-binding mode of 14-3-3.
15	PDB:5dseA	0.058	0.096	3.006	537	0.028	0.061	5dseA.pdb.gz
16	PDB:7qdrB	0.068	0.065	3.006	1212	0.016	0.016	7qdrB.pdb.gz
17	PDB:7ungA1	0.049	0.099	3.006	391	0.024	0.072	7ungA1.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
18	PDB:4bwrA	0.039	0.076	3.154	467	0.021	0.051	4bwrA.pdb.gz	Crystal Structure of C5321: A Protective Antigen Present in Uropathogenic Escherichia Coli Strains Displaying an Slr Fold.
19	PDB:7ungA3	0.049	0.113	3.310	333	0.025	0.087	7ungA3.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
20	PDB:7sudA	0.063	0.025	3.474	3740	0.025	0.008	7sudA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6GE44	0.0	1819	1130	0.909	0.935	A0A8I6GE44_RAT AF4/FMR2 family, member 4 OS=Rattus norvegicus OX=10116 GN=Aff4 PE=3 SV=1
2	A0A8I6GGV9	0.0	1762	1120	0.889	0.923	A0A8I6GGV9_RAT AF4/FMR2 family, member 4 OS=Rattus norvegicus OX=10116 GN=Aff4 PE=3 SV=1
3	D3ZSX2	0.0	1898	1159	0.933	0.936	D3ZSX2_RAT AF4/FMR2 family, member 4 OS=Rattus norvegicus OX=10116 GN=Aff4 PE=1 SV=3
4	Q8TAX5	0.0	744	365	0.311	0.992	Q8TAX5_HUMAN AFF4 protein OS=Homo sapiens OX=9606 GN=AFF4 PE=1 SV=1
5	Q9ESC8	0.0	1894	1160	0.921	0.923	AFF4_MOUSE AF4/FMR2 family member 4 OS=Mus musculus OX=10090 GN=Aff4 PE=1 SV=1
6	Q9UHB7	0.0	2351	1163	1.000	1.000	AFF4_HUMAN AF4/FMR2 family member 4 OS=Homo sapiens OX=9606 GN=AFF4 PE=1 SV=1
7	P51826	3.91e-134	441	1226	0.334	0.317	AFF3_HUMAN AF4/FMR2 family member 3 OS=Homo sapiens OX=9606 GN=AFF3 PE=1 SV=3
8	H7C4C2	1.23e-91	308	580	0.192	0.384	H7C4C2_HUMAN ALF transcription elongation factor 3 (Fragment) OS=Homo sapiens OX=9606 GN=AFF3 PE=1 SV=2
9	P51827	2.66e-83	299	1254	0.166	0.154	AFF3_MOUSE AF4/FMR2 family member 3 OS=Mus musculus OX=10090 GN=Aff3 PE=1 SV=2
10	O55112	1.19e-82	297	1272	0.127	0.116	AFF2_MOUSE AF4/FMR2 family member 2 OS=Mus musculus OX=10090 GN=Aff2 PE=2 SV=2
11	P51816	5.20e-82	295	1311	0.127	0.113	AFF2_HUMAN AF4/FMR2 family member 2 OS=Homo sapiens OX=9606 GN=AFF2 PE=1 SV=4
12	P51825	9.88e-72	264	1210	0.211	0.202	AFF1_HUMAN AF4/FMR2 family member 1 OS=Homo sapiens OX=9606 GN=AFF1 PE=1 SV=1
13	O88573	1.81e-55	213	1216	0.174	0.166	AFF1_MOUSE AF4/FMR2 family member 1 OS=Mus musculus OX=10090 GN=Aff1 PE=1 SV=2
14	Q9VQI9	8.48e-25	115	1673	0.069	0.048	AFFL_DROME AF4/FMR2 family member lilli OS=Drosophila melanogaster OX=7227 GN=lilli PE=1 SV=2
15	F4IZK5	0.008	43.1	1403	0.027	0.022	F4IZK5_ARATH CW-type Zinc Finger OS=Arabidopsis thaliana OX=3702 GN=At3g62900 PE=1 SV=2
16	Q0DRX6	0.13	38.9	902	0.036	0.047	CWZF3_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05110 AF-4	6.5e-169	575.1	AF-4 proto-oncoprotein N-terminal region
2	PF18876 AF-4_C	2.1e-126	432.3	AF-4 proto-oncoprotein C-terminal region
3	PF18875 AF4_int	0.012	26.4	AF4 interaction motif
4	PF08192 Peptidase_S64	5.2	17.1	Peptidase family S64

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265343

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252674	0.999	Protein ENL
2	9606.ENSP00000261900	0.999	Cyclin-T1
3	9606.ENSP00000362361	0.999	Cyclin-dependent kinase 9
4	9606.ENSP00000369695	0.999	Protein AF-9
5	9606.ENSP00000237853	0.998	RNA polymerase II elongation factor ELL2
6	9606.ENSP00000262809	0.998	RNA polymerase II elongation factor ELL
7	9606.ENSP00000380054	0.985	ELL-associated factor 1
8	9606.ENSP00000264157	0.984	Cyclin-T2
9	9606.ENSP00000273668	0.978	ELL-associated factor 2
10	9606.ENSP00000320346	0.912	RNA polymerase II elongation factor ELL3
11	9606.ENSP00000328773	0.910	Protein HEXIM1
12	9606.ENSP00000326806	0.900	Nuclear cap-binding protein subunit 2
13	9606.ENSP00000364289	0.900	Nuclear cap-binding protein subunit 1
14	9606.ENSP00000428426	0.861	Transcription elongation factor A protein 1
15	9606.ENSP00000295321	0.853	Protein IWS1 homolog
16	9606.ENSP00000380888	0.853	Mediator of RNA polymerase II transcription subunit 13
17	9606.ENSP00000319104	0.827	Transcription elongation factor SPT6
18	9606.ENSP00000484525	0.819	RNA polymerase II subunit A C-terminal domain phosphatase
19	9606.ENSP00000299601	0.814	RNA polymerase-associated protein LEO1
20	9606.ENSP00000470252	0.811	Transcription elongation factor SPT5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.408	organic cyclic compound binding
GO:0003676	0.377	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0034976	0.998	response to endoplasmic reticulum stress
GO:0050794	0.434	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0140513	0.998	nuclear protein-containing complex
GO:0008023	0.959	transcription elongation factor complex
GO:0005730	0.723	nucleolus
GO:0005737	0.709	cytoplasm
GO:0000785	0.583	chromatin
GO:0001650	0.399	fibrillar center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]