StarFunc result for job id Q9UHC1

User Input

>input (1453 residues)
MIKCLSVEVQAKLRSGLAISSLGQCVEELALNSIDAEAKCVAVRVNMETFQVQVIDNGFG
MGSDDVEKVGNRYFTSKCHSVQDLENPRFYGFRGEALANIADMASAVEISSKKNRTMKTF
VKLFQSGKALKACEADVTRASAGTTVTVYNLFYQLPVRRKCMDPRLEFEKVRQRIEALSL
MHPSISFSLRNDVSGSMVLQLPKTKDVCSRFCQIYGLGKSQKLREISFKYKEFELSGYIS
SEAHYNKNMQFLFVNKRLVLRTKLHKLIDFLLRKESIICKPKNGPTSRQMNSSLRHRSTP
ELYGIYVINVQCQFCEYDVCMEPAKTLIEFQNWDTLLFCIQEGVKMFLKQEKLFVELSGE
DIKEFSEDNGFSLFDATLQKRVTSDERSNFQEACNNILDSYEMFNLQSKAVKRKTTAENV
NTQSSRDSEATRKNTNDAFLYIYESGGPGHSKMTEPSLQNKDSSCSESKMLEQETIVASE
AGENEKHKKSFLEHSSLENPCGTSLEMFLSPFQTPCHFEESGQDLEIWKESTTVNGMAAN
ILKNNRIQNQPKRFKDATEVGCQPLPFATTLWGVHSAQTEKEKKKESSNCGRRNVFSYGR
VKLCSTGFITHVVQNEKTKSTETEHSFKNYVRPGPTRAQETFGNRTRHSVETPDIKDLAS
TLSKESGQLPNKKNCRTNISYGLENEPTATYTMFSAFQEGSKKSQTDCILSDTSPSFPWY
RHVSNDSRKTDKLIGFSKPIVRKKLSLSSQLGSLEKFKRQYGKVENPLDTEVEESNGVTT
NLSLQVEPDILLKDKNRLENSDVCKITTMEHSDSDSSCQPASHILNSEKFPFSKDEDCLE
QQMPSLRESPMTLKELSLFNRKPLDLEKSSESLASKLSRLKGSERETQTMGMMSRFNELP
NSDSSRKDSKLCSVLTQDFCMLFNNKHEKTENGVIPTSDSATQDNSFNKNSKTHSNSNTT
ENCVISETPLVLPYNNSKVTGKDSDVLIRASEQQIGSLDSPSGMLMNPVEDATGDQNGIC
FQSEESKARACSETEESNTCCSDWQRHFDVALGRMVYVNKMTGLSTFIAPTEDIQAACTK
DLTTVAVDVVLENGSQYRCQPFRSDLVLPFLPRARAERTVMRQDNRDTVDDTVSSESLQS
LFSEWDNPVFARYPEVAVDVSSGQAESLAVKIHNILYPYRFTKGMIHSMQVLQQVDNKFI
ACLMSTKTEENGEAGGNLLVLVDQHAAHERIRLEQLIIDSYEKQQAQGSGRKKLLSSTLI
PPLEITVTEEQRRLLWCYHKNLEDLGLEFVFPDTSDSLVLVGKVPLCFVEREANELRRGR
STVTKSIVEEFIREQLELLQTTGGIQGTLPLTVQKVLASQACHGAIKFNDGLSLQESCRL
IEALSSCQLPFQCAHGRPSMLPLADIDHLEQEKQIKPNLTKLRKMAQAWRLFGKAECDTR
QSLQQSMPPCEPP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1Y7VMP7	0.465	0.468	0.000	1443	0.717	0.722	A0A1Y7VMP7.pdb.gz	A0A1Y7VMP7_MOUSE MutL homolog 3 OS=Mus musculus OX=10090 GN=Mlh3 PE=1 SV=1
2	AFDB:G3V419	0.273	0.307	0.000	1275	0.872	0.994	G3V419.pdb.gz	G3V419_HUMAN MutL homolog 3 OS=Homo sapiens OX=9606 GN=MLH3 PE=1 SV=1
3	AFDB:Q9UHC1	1.000	1.000	0.000	1453	1.000	1.000	Q9UHC1.pdb.gz	MLH3_HUMAN DNA mismatch repair protein Mlh3 OS=Homo sapiens OX=9606 GN=MLH3 PE=1 SV=3
4	AFDB:F4JN26	0.204	0.254	7.480E-44	1155	0.187	0.235	F4JN26.pdb.gz	MLH3_ARATH DNA mismatch repair protein MLH3 OS=Arabidopsis thaliana OX=3702 GN=MLH3 PE=2 SV=2
5	PDB:7p8vA	0.208	0.856	1.603E-23	331	0.053	0.233	7p8vA.pdb.gz	MutL binds to 3' resected DNA ends and blocks DNA polymerase access.
6	PDB:6rkwD	0.173	0.302	3.459E-13	781	0.044	0.082	6rkwD.pdb.gz	Cryo-EM structure of the complete E. coli DNA gyrase nucleoprotein complex.
7	PDB:7kw7B	0.159	0.333	1.683E-11	628	0.041	0.094	7kw7B.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
8	PDB:2iopA	0.107	0.230	1.381E-10	618	0.039	0.091	2iopA.pdb.gz	Structural Analysis of E. coli hsp90 reveals dramatic nucleotide-dependent conformational rearrangements.
9	PDB:7kclB	0.168	0.358	1.623E-10	614	0.039	0.091	7kclB.pdb.gz	Cryo-EM reveals the dynamic interplay between mitochondrial Hsp90 and SdhB folding intermediates
10	PDB:2cg9B	0.171	0.361	1.713E-10	618	0.032	0.076	2cg9B.pdb.gz	Crystal Structure of an Hsp90-Nucleotide-P23/Sba1 Closed Chaperone Complex
11	PDB:2zbkB	0.167	0.438	1.713E-10	506	0.039	0.113	2zbkB.pdb.gz	Crystal Structure of an Intact Type II DNA Topoisomerase: Insights into DNA Transfer Mechanisms
12	PDB:5fwkA	0.166	0.345	2.014E-10	638	0.038	0.086	5fwkA.pdb.gz	Atomic Structure of Hsp90-Cdc37-Cdk4 Reveals that Hsp90 Traps and Stabilizes an Unfolded Kinase.
13	PDB:5tthA	0.164	0.325	2.939E-10	671	0.036	0.079	5tthA.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
14	PDB:1y4uB	0.101	0.257	3.455E-10	454	0.034	0.110	1y4uB.pdb.gz
15	AFDB:Q9Z0Y7	0.052	0.058	1.624E-2	1216	0.097	0.116	Q9Z0Y7.pdb.gz	IRS4_MOUSE Insulin receptor substrate 4 OS=Mus musculus OX=10090 GN=Irs4 PE=1 SV=2
16	AFDB:O14654	0.051	0.055	1.133E-1	1257	0.085	0.098	O14654.pdb.gz	IRS4_HUMAN Insulin receptor substrate 4 OS=Homo sapiens OX=9606 GN=IRS4 PE=1 SV=1
17	AFDB:B5DE26	0.036	0.040	1.332E-1	1182	0.080	0.098	B5DE26.pdb.gz
18	AFDB:Q90X22	0.044	0.048	1.332E-1	1276	0.101	0.115	Q90X22.pdb.gz
19	AFDB:Q5SYB0	0.048	0.046	2.050E-1	1578	0.123	0.113	Q5SYB0.pdb.gz	FRPD1_HUMAN FERM and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FRMPD1 PE=1 SV=1
20	AFDB:Q86YC2	0.041	0.045	2.050E-1	1186	0.087	0.106	Q86YC2.pdb.gz	PALB2_HUMAN Partner and localizer of BRCA2 OS=Homo sapiens OX=9606 GN=PALB2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1Y7VMP7	0.0	2053	1443	0.719	0.723	A0A1Y7VMP7_MOUSE MutL homolog 3 OS=Mus musculus OX=10090 GN=Mlh3 PE=1 SV=1
2	G3V419	0.0	2271	1275	0.754	0.860	G3V419_HUMAN MutL homolog 3 OS=Homo sapiens OX=9606 GN=MLH3 PE=1 SV=1
3	H0YJB4	0.0	977	477	0.328	0.998	H0YJB4_HUMAN MutL homolog 3 (Fragment) OS=Homo sapiens OX=9606 GN=MLH3 PE=1 SV=1
4	Q3TRU3	0.0	1243	997	0.458	0.667	Q3TRU3_MOUSE MutL C-terminal dimerisation domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Mlh3 PE=2 SV=1
5	Q3V1X3	0.0	1977	1411	0.700	0.721	Q3V1X3_MOUSE MutL homolog 3 OS=Mus musculus OX=10090 GN=Mlh3 PE=2 SV=1
6	Q68FG1	0.0	1984	1411	0.702	0.723	Q68FG1_MOUSE MutL homolog 3 OS=Mus musculus OX=10090 GN=Mlh3 PE=1 SV=1
7	Q8BZC3	0.0	752	434	0.250	0.836	Q8BZC3_MOUSE DNA mismatch repair protein S5 domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Mlh3 PE=2 SV=1
8	Q8C0U7	0.0	1265	934	0.447	0.696	Q8C0U7_MOUSE MutL C-terminal dimerisation domain-containing protein OS=Mus musculus OX=10090 GN=Mlh3 PE=2 SV=1
9	Q8R407	0.0	620	338	0.202	0.867	Q8R407_MOUSE MutL-like protein 3 (Fragment) OS=Mus musculus OX=10090 GN=Mlh3 PE=2 SV=1
10	Q9UHC1	0.0	3022	1453	1.000	1.000	MLH3_HUMAN DNA mismatch repair protein Mlh3 OS=Homo sapiens OX=9606 GN=MLH3 PE=1 SV=3
11	A0A1Y7VJX4	4.73e-97	311	197	0.107	0.787	A0A1Y7VJX4_MOUSE MutL homolog 3 (Fragment) OS=Mus musculus OX=10090 GN=Mlh3 PE=1 SV=1
12	Q99L38	4.02e-94	303	192	0.104	0.786	Q99L38_MOUSE Mlh3 protein OS=Mus musculus OX=10090 GN=Mlh3 PE=2 SV=1
13	F4JN26	9.52e-30	131	1155	0.070	0.087	MLH3_ARATH DNA mismatch repair protein MLH3 OS=Arabidopsis thaliana OX=3702 GN=MLH3 PE=2 SV=2
14	Q12083	3.44e-26	118	715	0.063	0.129	MLH3_YEAST DNA mismatch repair protein MLH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MLH3 PE=1 SV=1
15	A0A669KBK2	2.68e-24	112	633	0.071	0.163	A0A669KBK2_HUMAN MutL homolog 1 OS=Homo sapiens OX=9606 GN=MLH1 PE=1 SV=1
16	P40692	5.57e-24	111	756	0.071	0.136	MLH1_HUMAN DNA mismatch repair protein Mlh1 OS=Homo sapiens OX=9606 GN=MLH1 PE=1 SV=1
17	H0Y818	8.66e-24	110	679	0.070	0.149	H0Y818_HUMAN MutL homolog 1 (Fragment) OS=Homo sapiens OX=9606 GN=MLH1 PE=1 SV=1
18	A0A669KAW3	1.15e-23	110	686	0.069	0.146	A0A669KAW3_HUMAN MutL homolog 1 (Fragment) OS=Homo sapiens OX=9606 GN=MLH1 PE=1 SV=1
19	P54280	1.13e-22	107	794	0.058	0.107	PMS1_SCHPO DNA mismatch repair protein pms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pms1 PE=3 SV=1
20	Q9JK91	1.22e-22	107	760	0.069	0.132	MLH1_MOUSE DNA mismatch repair protein Mlh1 OS=Mus musculus OX=10090 GN=Mlh1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01119 DNA_mis_repair	1.3e-07	42.7	DNA mismatch repair protein, C-terminal domain
2	PF02518 HATPase_c	0.012	27.5	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
3	PF13589 HATPase_c_3	0.0073	27.7	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
4	PF08676 MutL_C	1.6e-08	45.8	MutL C terminal dimerisation domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348020

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263187	0.995	MutS protein homolog 4
2	9606.ENSP00000231790	0.992	DNA mismatch repair protein Mlh1
3	9606.ENSP00000233146	0.991	DNA mismatch repair protein Msh2
4	9606.ENSP00000234420	0.989	DNA mismatch repair protein Msh6
5	9606.ENSP00000265081	0.982	DNA mismatch repair protein Msh3
6	9606.ENSP00000364855	0.979	MutS protein homolog 5
7	9606.ENSP00000355506	0.978	Exonuclease 1
8	9606.ENSP00000372088	0.907	DNA repair protein RAD51 homolog 1
9	9606.ENSP00000442336	0.901	DNA topoisomerase 3-alpha
10	9606.ENSP00000347232	0.882	Bloom syndrome protein
11	9606.ENSP00000307853	0.868	Crossover junction endonuclease MUS81
12	9606.ENSP00000347978	0.839	DNA repair protein complementing XP-G cells
13	9606.ENSP00000369497	0.834	Breast cancer type 2 susceptibility protein
14	9606.ENSP00000216024	0.824	Meiotic recombination protein DMC1/LIM15 homolog
15	9606.ENSP00000406046	0.823	DNA polymerase delta catalytic subunit
16	9606.ENSP00000360310	0.819	Meiotic recombination protein SPO11
17	9606.ENSP00000359454	0.817	Probable ATP-dependent DNA helicase HFM1
18	9606.ENSP00000278616	0.794	Serine-protein kinase ATM
19	9606.ENSP00000364270	0.791	DNA repair protein complementing XP-A cells
20	9606.ENSP00000013807	0.787	DNA excision repair protein ERCC-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.994	protein binding
GO:0003682	0.994	chromatin binding
GO:0019237	0.992	centromeric DNA binding
GO:0003696	0.582	satellite DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051716	0.987	cellular response to stimulus
GO:0006950	0.986	response to stress
GO:0006259	0.985	DNA metabolic process
GO:0006281	0.984	DNA repair
GO:0051276	0.974	chromosome organization
GO:0007049	0.968	cell cycle
GO:0140013	0.948	meiotic nuclear division
GO:0070193	0.943	synaptonemal complex organization
GO:0061982	0.942	meiosis I cell cycle process
GO:0007127	0.933	meiosis I
GO:0051179	0.872	localization
GO:0045143	0.870	homologous chromosome segregation
GO:0022607	0.842	cellular component assembly
GO:0006298	0.802	mismatch repair
GO:0007129	0.797	homologous chromosome pairing at meiosis
GO:0032501	0.740	multicellular organismal process
GO:0007130	0.725	synaptonemal complex assembly
GO:0007140	0.716	male meiotic nuclear division
GO:0007143	0.683	female meiotic nuclear division
GO:0051641	0.658	cellular localization
GO:0033036	0.656	macromolecule localization
GO:0008104	0.610	protein localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.984	protein-containing complex
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:0005694	0.930	chromosome
GO:0000228	0.603	nuclear chromosome
GO:0005737	0.595	cytoplasm
GO:0000793	0.376	condensed chromosome
GO:0032300	0.322	mismatch repair complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]