StarFunc result for job id Q9UHC6

User Input

>input (1331 residues)
MQAAPRAGCGAALLLWIVSSCLCRAWTAPSTSQKCDEPLVSGLPHVAFSSSSSISGSYSP
GYAKINKRGGAGGWSPSDSDHYQWLQVDFGNRKQISAIATQGRYSSSDWVTQYRMLYSDT
GRNWKPYHQDGNIWAFPGNINSDGVVRHELQHPIIARYVRIVPLDWNGEGRIGLRIEVYG
CSYWADVINFDGHVVLPYRFRNKKMKTLKDVIALNFKTSESEGVILHGEGQQGDYITLEL
KKAKLVLSLNLGSNQLGPIYGHTSVMTGSLLDDHHWHSVVIERQGRSINLTLDRSMQHFR
TNGEFDYLDLDYEITFGGIPFSGKPSSSSRKNFKGCMESINYNGVNITDLARRKKLEPSN
VGNLSFSCVEPYTVPVFFNATSYLEVPGRLNQDLFSVSFQFRTWNPNGLLVFSHFADNLG
NVEIDLTESKVGVHINITQTKMSQIDISSGSGLNDGQWHEVRFLAKENFAILTIDGDEAS
AVRTNSPLQVKTGEKYFFGGFLNQMNNSSHSVLQPSFQGCMQLIQVDDQLVNLYEVAQRK
PGSFANVSIDMCAIIDRCVPNHCEHGGKCSQTWDSFKCTCDETGYSGATCHNSIYEPSCE
AYKHLGQTSNYYWIDPDGSGPLGPLKVYCNMTEDKVWTIVSHDLQMQTPVVGYNPEKYSV
TQLVYSASMDQISAITDSAEYCEQYVSYFCKMSRLLNTPDGSPYTWWVGKANEKHYYWGG
SGPGIQKCACGIERNCTDPKYYCNCDADYKQWRKDAGFLSYKDHLPVSQVVVGDTDRQGS
EAKLSVGPLRCQGDRNYWNAASFPNPSSYLHFSTFQGETSADISFYFKTLTPWGVFLENM
GKEDFIKLELKSATEVSFSFDVGNGPVEIVVRSPTPLNDDQWHRVTAERNVKQASLQVDR
LPQQIRKAPTEGHTRLELYSQLFVGGAGGQQGFLGCIRSLRMNGVTLDLEERAKVTSGFI
SGCSGHCTSYGTNCENGGKCLERYHGYSCDCSNTAYDGTFCNKDVGAFFEEGMWLRYNFQ
APATNARDSSSRVDNAPDQQNSHPDLAQEEIRFSFSTTKAPCILLYISSFTTDFLAVLVK
PTGSLQIRYNLGGTREPYNIDVDHRNMANGQPHSVNITRHEKTIFLKLDHYPSVSYHLPS
SSDTLFNSPKSLFLGKVIETGKIDQEIHKYNTPGFTGCLSRVQFNQIAPLKAALRQTNAS
AHVHIQGELVESNCGASPLTLSPMSSATDPWHLDHLDSASADFPYNPGQGQAIRNGVNRN
SAIIGGVIAVVIFTILCTLVFLIRYMFRHKGTYHTNEAKGAESAESADAAIMNNDPNFTE
TIDESKKEWLI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PY62	0.832	0.859	0.000	1287	0.446	0.462	E9PY62.pdb.gz	E9PY62_MOUSE Contactin associated protein-like 3 OS=Mus musculus OX=10090 GN=Cntnap3 PE=1 SV=1
2	AFDB:O54991	0.659	0.635	0.000	1385	0.434	0.417	O54991.pdb.gz	CNTP1_MOUSE Contactin-associated protein 1 OS=Mus musculus OX=10090 GN=Cntnap1 PE=1 SV=2
3	AFDB:Q94887	0.595	0.615	0.000	1284	0.316	0.327	Q94887.pdb.gz	NRX4_DROME Neurexin-4 OS=Drosophila melanogaster OX=7227 GN=Nrx-IV PE=1 SV=2
4	AFDB:Q99P47	0.823	0.836	0.000	1310	0.470	0.478	Q99P47.pdb.gz	CNTP4_MOUSE Contactin-associated protein-like 4 OS=Mus musculus OX=10090 GN=Cntnap4 PE=1 SV=2
5	AFDB:Q9C0A0	0.826	0.840	0.000	1308	0.478	0.486	Q9C0A0.pdb.gz	CNTP4_HUMAN Contactin-associated protein-like 4 OS=Homo sapiens OX=9606 GN=CNTNAP4 PE=1 SV=3
6	AFDB:Q9CPW0	0.896	0.895	0.000	1332	0.934	0.933	Q9CPW0.pdb.gz	CNTP2_MOUSE Contactin-associated protein-like 2 OS=Mus musculus OX=10090 GN=Cntnap2 PE=1 SV=2
7	AFDB:Q19617	0.510	0.567	1.799E-74	1180	0.213	0.241	Q19617.pdb.gz	NLR1_CAEEL Neurexin like receptor 1 OS=Caenorhabditis elegans OX=6239 GN=nlr-1 PE=1 SV=3
8	AFDB:M9PE65	0.377	0.257	3.715E-70	2179	0.215	0.131	M9PE65.pdb.gz	AXO_DROME Axotactin OS=Drosophila melanogaster OX=7227 GN=axo PE=1 SV=1
9	AFDB:Q9ULB1	0.170	0.156	7.376E-62	1477	0.215	0.194	Q9ULB1.pdb.gz	NRX1A_HUMAN Neurexin-1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
10	AFDB:A1XQX0	0.167	0.151	1.426E-60	1491	0.219	0.196	A1XQX0.pdb.gz	NR1AA_DANRE Neurexin-1a OS=Danio rerio OX=7955 GN=nrxn1a PE=2 SV=1
11	PDB:2w94A	0.106	0.513	2.210E-8	254	0.043	0.224	2w94A.pdb.gz	Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
12	PDB:4bxsV	0.105	0.110	2.551E-8	1262	0.048	0.051	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
13	PDB:7kveB	0.105	0.102	2.807E-8	1374	0.041	0.040	7kveB.pdb.gz
14	PDB:2vmeA	0.101	0.484	1.069E-7	256	0.040	0.207	2vmeA.pdb.gz	Structure Determination of Discoidin II from Dictyostelium Discoideum and Carbohydrate Binding Properties of the Lectin Domain.
15	PDB:3jd6O	0.102	0.741	5.968E-7	167	0.038	0.305	3jd6O.pdb.gz
16	PDB:3ffzA	0.090	0.095	1.100E-5	1246	0.031	0.033	3ffzA.pdb.gz	Domain organization in Clostridium botulinum neurotoxin type E is unique: its implication in faster translocation.
17	PDB:7tzcA	0.069	0.033	1.536E-5	4404	0.070	0.021	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
18	PDB:7zl1A	0.104	0.539	2.361E-5	215	0.017	0.107	7zl1A.pdb.gz
19	PDB:4pbpB	0.106	0.570	2.725E-5	210	0.024	0.152	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
20	PDB:3v0aB	0.091	0.103	3.993E-5	1150	0.026	0.030	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6GH02	0.0	2597	1332	0.937	0.936	A0A8I6GH02_RAT Contactin associated protein 2 OS=Rattus norvegicus OX=10116 GN=Cntnap2 PE=3 SV=1
2	D8WUA6	0.0	2323	1328	0.845	0.847	D8WUA6_TAEGU Contactin associated protein-like 2 OS=Taeniopygia guttata OX=59729 GN=CNTNAP2 PE=2 SV=1
3	E9PY62	0.0	1158	1287	0.449	0.465	E9PY62_MOUSE Contactin associated protein-like 3 OS=Mus musculus OX=10090 GN=Cntnap3 PE=1 SV=1
4	O54991	0.0	1123	1385	0.431	0.414	CNTP1_MOUSE Contactin-associated protein 1 OS=Mus musculus OX=10090 GN=Cntnap1 PE=1 SV=2
5	P78357	0.0	1141	1384	0.434	0.418	CNTP1_HUMAN Contactin-associated protein 1 OS=Homo sapiens OX=9606 GN=CNTNAP1 PE=1 SV=1
6	P97846	0.0	1127	1381	0.430	0.414	CNTP1_RAT Contactin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Cntnap1 PE=1 SV=1
7	Q94887	0.0	646	1284	0.316	0.328	NRX4_DROME Neurexin-4 OS=Drosophila melanogaster OX=7227 GN=Nrx-IV PE=1 SV=2
8	Q99P47	0.0	1239	1310	0.474	0.482	CNTP4_MOUSE Contactin-associated protein-like 4 OS=Mus musculus OX=10090 GN=Cntnap4 PE=1 SV=2
9	Q9C0A0	0.0	1279	1308	0.476	0.485	CNTP4_HUMAN Contactin-associated protein-like 4 OS=Homo sapiens OX=9606 GN=CNTNAP4 PE=1 SV=3
10	Q9CPW0	0.0	2597	1332	0.939	0.938	CNTP2_MOUSE Contactin-associated protein-like 2 OS=Mus musculus OX=10090 GN=Cntnap2 PE=1 SV=2
11	Q9UHC6	0.0	2790	1331	1.000	1.000	CNTP2_HUMAN Contactin-associated protein-like 2 OS=Homo sapiens OX=9606 GN=CNTNAP2 PE=1 SV=1
12	Q3URC6	8.53e-138	433	510	0.176	0.459	Q3URC6_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Cntnap3 PE=2 SV=1
13	M9PE65	4.68e-68	256	2179	0.186	0.113	AXO_DROME Axotactin OS=Drosophila melanogaster OX=7227 GN=axo PE=1 SV=1
14	Q19617	1.60e-61	233	1180	0.212	0.239	NLR1_CAEEL Neurexin like receptor 1 OS=Caenorhabditis elegans OX=6239 GN=nlr-1 PE=1 SV=3
15	Q9XYX0	6.28e-54	210	1685	0.181	0.143	Q9XYX0_DROME AXO OS=Drosophila melanogaster OX=7227 GN=axo PE=2 SV=1
16	Q9ULB1	6.04e-39	161	1477	0.118	0.106	NRX1A_HUMAN Neurexin-1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
17	A0A0R4J2G7	2.04e-36	153	1495	0.118	0.105	A0A0R4J2G7_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
18	E7ERL8	2.04e-36	153	1507	0.118	0.104	E7ERL8_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
19	A0A1D5RMU6	2.10e-36	153	1499	0.118	0.105	A0A1D5RMU6_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
20	Q9CS84	3.53e-36	152	1514	0.118	0.104	NRX1A_MOUSE Neurexin-1 OS=Mus musculus OX=10090 GN=Nrxn1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01410 COLFI	0.61	20.9	Fibrillar collagen C-terminal domain
2	PF00008 EGF	1.7	20.3	EGF-like domain
3	PF00754 F5_F8_type_C	1.3e-28	111.0	F5/8 type C domain
4	PF12661 hEGF	83	15.3	Human growth factor-like EGF
5	PF00054 Laminin_G_1	1e-62	221.6	Laminin G domain
6	PF02210 Laminin_G_2	1e-92	318.7	Laminin G domain
7	PF13385 Laminin_G_3	6.6e-09	47.5	Concanavalin A-like lectin/glucanases superfamily
8	PF01284 MARVEL	4.9e+02	12.1	Membrane-associating domain
9	PF01034 Syndecan	1.3e+02	13.9	Syndecan domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354778

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000330633	0.999	Contactin-2
2	9606.ENSP00000343158	0.989	Band 4.1-like protein 3
3	9606.ENSP00000371985	0.957	Potassium voltage-gated channel subfamily A member 1
4	9606.ENSP00000447006	0.944	Contactin-1
5	9606.ENSP00000345259	0.938	Protein 4.1
6	9606.ENSP00000360472	0.926	Leucine-rich glioma-inactivated protein 1
7	9606.ENSP00000433109	0.921	Potassium voltage-gated channel subfamily A member 2
8	9606.ENSP00000386200	0.918	Forkhead box protein P2
9	9606.ENSP00000370485	0.822	Neuroligin-4, X-linked
10	9606.ENSP00000344786	0.812	Neurofascin
11	9606.ENSP00000265727	0.787	Disintegrin and metalloproteinase domain-containing protein 22
12	9606.ENSP00000351591	0.785	Neuroligin-3
13	9606.ENSP00000288699	0.780	Dihydropyrimidinase-related protein 5
14	9606.ENSP00000429344	0.772	Paraneoplastic Ma antigens
15	9606.ENSP00000368314	0.771	Neuronal cell adhesion molecule
16	9606.ENSP00000259154	0.770	BTB/POZ domain-containing protein KCTD3
17	9606.ENSP00000380602	0.767	Contactin-4
18	9606.ENSP00000382428	0.760	Disks large homolog 4
19	9606.ENSP00000270642	0.752	IgLON family member 5
20	9606.ENSP00000469689	0.743	SH3 and multiple ankyrin repeat domains protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030165	0.960	PDZ domain binding
GO:0019899	0.622	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0007399	0.985	nervous system development
GO:0003008	0.976	system process
GO:0050877	0.962	nervous system process
GO:0048522	0.954	positive regulation of cellular process
GO:0050896	0.939	response to stimulus
GO:0050905	0.921	neuromuscular process
GO:0007610	0.863	behavior
GO:0010996	0.856	response to auditory stimulus
GO:0060322	0.852	head development
GO:0007417	0.851	central nervous system development
GO:0007420	0.797	brain development
GO:0008283	0.793	cell population proliferation
GO:0050890	0.778	cognition
GO:0071840	0.768	cellular component organization or biogenesis
GO:0016043	0.757	cellular component organization
GO:0051716	0.745	cellular response to stimulus
GO:0030534	0.738	adult behavior
GO:0007154	0.709	cell communication
GO:0035176	0.706	social behavior
GO:0007612	0.689	learning
GO:0048519	0.681	negative regulation of biological process
GO:0001964	0.675	startle response
GO:0048583	0.668	regulation of response to stimulus
GO:0065008	0.656	regulation of biological quality
GO:0034330	0.656	cell junction organization
GO:0021543	0.652	pallium development
GO:0010646	0.646	regulation of cell communication
GO:0048869	0.642	cellular developmental process
GO:0048585	0.635	negative regulation of response to stimulus
GO:0023052	0.614	signaling
GO:0022607	0.604	cellular component assembly
GO:0023051	0.594	regulation of signaling
GO:0048468	0.583	cell development
GO:0021761	0.530	limbic system development
GO:0032101	0.525	regulation of response to external stimulus
GO:0022008	0.437	neurogenesis
GO:0051179	0.429	localization
GO:0009653	0.411	anatomical structure morphogenesis
GO:0034329	0.352	cell junction assembly
GO:0051239	0.351	regulation of multicellular organismal process
GO:0050808	0.318	synapse organization
GO:0007165	0.311	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0030054	0.993	cell junction
GO:0043005	0.991	neuron projection
GO:0098590	0.985	plasma membrane region
GO:0044304	0.984	main axon
GO:0036477	0.980	somatodendritic compartment
GO:0045202	0.965	synapse
GO:0032991	0.952	protein-containing complex
GO:0043226	0.930	organelle
GO:0044297	0.911	cell body
GO:0043025	0.885	neuronal cell body
GO:0097447	0.869	dendritic tree
GO:0030425	0.860	dendrite
GO:0005622	0.852	intracellular anatomical structure
GO:0043227	0.806	membrane-bounded organelle
GO:0031252	0.742	cell leading edge
GO:0031253	0.718	cell projection membrane
GO:0005737	0.712	cytoplasm
GO:0032589	0.708	neuron projection membrane
GO:0043231	0.685	intracellular membrane-bounded organelle
GO:0030673	0.662	axolemma
GO:0097060	0.496	synaptic membrane
GO:0034703	0.480	cation channel complex
GO:0098793	0.445	presynapse
GO:0034705	0.444	potassium channel complex
GO:0098797	0.397	plasma membrane protein complex
GO:0008076	0.391	voltage-gated potassium channel complex
GO:0031982	0.362	vesicle
GO:0070013	0.356	intracellular organelle lumen
GO:0012505	0.314	endomembrane system
GO:0098978	0.304	glutamatergic synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]