StarFunc result for job id Q9UHC9

User Input

>input (1359 residues)
MAEAGLRGWLLWALLLRLAQSEPYTTIHQPGYCAFYDECGKNPELSGSLMTLSNVSCLSN
TPARKITGDHLILLQKICPRLYTGPNTQACCSAKQLVSLEASLSITKALLTRCPACSDNF
VNLHCHNTCSPNQSLFINVTRVAQLGAGQLPAVVAYEAFYQHSFAEQSYDSCSRVRVPAA
ATLAVGTMCGVYGSALCNAQRWLNFQGDTGNGLAPLDITFHLLEPGQAVGSGIQPLNEGV
ARCNESQGDDVATCSCQDCAASCPAIARPQALDSTFYLGQMPGSLVLIIILCSVFAVVTI
LLVGFRVAPARDKSKMVDPKKGTSLSDKLSFSTHTLLGQFFQGWGTWVASWPLTILVLSV
IPVVALAAGLVFTELTTDPVELWSAPNSQARSEKAFHDQHFGPFFRTNQVILTAPNRSSY
RYDSLLLGPKNFSGILDLDLLLELLELQERLRHLQVWSPEAQRNISLQDICYAPLNPDNT
SLYDCCINSLLQYFQNNRTLLLLTANQTLMGQTSQVDWKDHFLYCANAPLTFKDGTALAL
SCMADYGAPVFPFLAIGGYKGKDYSEAEALIMTFSLNNYPAGDPRLAQAKLWEEAFLEEM
RAFQRRMAGMFQVTFMAERSLEDEINRTTAEDLPIFATSYIVIFLYISLALGSYSSWSRV
MVDSKATLGLGGVAVVLGAVMAAMGFFSYLGIRSSLVILQVVPFLVLSVGADNIFIFVLE
YQRLPRRPGEPREVHIGRALGRVAPSMLLCSLSEAICFFLGALTPMPAVRTFALTSGLAV
ILDFLLQMSAFVALLSLDSKRQEASRLDVCCCVKPQELPPPGQGEGLLLGFFQKAYAPFL
LHWITRGVVLLLFLALFGVSLYSMCHISVGLDQELALPKDSYLLDYFLFLNRYFEVGAPV
YFVTTLGYNFSSEAGMNAICSSAGCNNFSFTQKIQYATEFPEQSYLAIPASSWVDDFIDW
LTPSSCCRLYISGPNKDKFCPSTVNSLNCLKNCMSITMGSVRPSVEQFHKYLPWFLNDRP
NIKCPKGGLAAYSTSVNLTSDGQVLDTVAILSPRLEYSGTISAHCNLYLLDSTSRFMAYH
KPLKNSQDYTEALRAARELAANITADLRKVPGTDPAFEVFPYTITNVFYEQYLTILPEGL
FMLSLCLVPTFAVSCLLLGLDLRSGLLNLLSIVMILVDTVGFMALWGISYNAVSLINLVS
AVGMSVEFVSHITRSFAISTKPTWLERAKEATISMGSAVFAGVAMTNLPGILVLGLAKAQ
LIQIFFFRLNLLITLLGLLHGLVFLPVILSYVGPDVNPALALEQKRAEEAVAAVMVASCP
NHPSRVSTADNIYVNHSFEGSIKGAGAISNFLPNNGRQF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6v3fA	0.757	0.830	0.000	1234	0.730	0.804	6v3fA.pdb.gz	Cryo-EM structures of NPC1L1 reveal mechanisms of cholesterol transport and ezetimibe inhibition
2	AFDB:A0A2R8Q2J0	0.852	0.905	0.000	1277	0.371	0.395	A0A2R8Q2J0.pdb.gz	A0A2R8Q2J0_DANRE Niemann-Pick C1 protein isoform X1 OS=Danio rerio OX=7955 GN=im:7149020 PE=1 SV=1
3	AFDB:G3V7K5	0.853	0.905	0.000	1278	0.379	0.403	G3V7K5.pdb.gz	G3V7K5_RAT NPC intracellular cholesterol transporter 1 OS=Rattus norvegicus OX=10116 GN=Npc1 PE=3 SV=1
4	AFDB:O15118	0.849	0.901	0.000	1278	0.372	0.396	O15118.pdb.gz	NPC1_HUMAN NPC intracellular cholesterol transporter 1 OS=Homo sapiens OX=9606 GN=NPC1 PE=1 SV=2
5	AFDB:Q6T3U4	0.934	0.953	0.000	1333	0.758	0.773	Q6T3U4.pdb.gz	NPCL1_MOUSE NPC1-like intracellular cholesterol transporter 1 OS=Mus musculus OX=10090 GN=Npc1l1 PE=1 SV=1
6	AFDB:Q9UHC9	1.000	1.000	0.000	1359	1.000	1.000	Q9UHC9.pdb.gz	NPCL1_HUMAN NPC1-like intracellular cholesterol transporter 1 OS=Homo sapiens OX=9606 GN=NPC1L1 PE=1 SV=2
7	AFDB:Q9VL24	0.848	0.894	1.428E-102	1287	0.358	0.378	Q9VL24.pdb.gz	Q9VL24_DROME Niemann-Pick type C-1a, isoform A OS=Drosophila melanogaster OX=7227 GN=Npc1a PE=1 SV=2
8	AFDB:Q9VRC9	0.830	0.897	2.587E-94	1254	0.306	0.332	Q9VRC9.pdb.gz	NPC1B_DROME NPC intracellular cholesterol transporter 1 homolog 1b OS=Drosophila melanogaster OX=7227 GN=Npc1b PE=2 SV=2
9	AFDB:F4I9G5	0.784	0.844	6.200E-88	1260	0.313	0.338	F4I9G5.pdb.gz	F4I9G5_ARATH Patched family protein OS=Arabidopsis thaliana OX=3702 GN=ATNPC1 PE=1 SV=2
10	AFDB:F4JTN1	0.798	0.835	5.277E-87	1297	0.319	0.335	F4JTN1.pdb.gz	F4JTN1_ARATH Patched family protein OS=Arabidopsis thaliana OX=3702 GN=ATNPC1-2 PE=1 SV=1
11	AFDB:Q5BBG1	0.751	0.800	1.409E-82	1271	0.302	0.323	Q5BBG1.pdb.gz	Q5BBG1_EMENI SSD domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02119 PE=3 SV=1
12	PDB:6dmyA	0.517	0.694	1.774E-34	992	0.173	0.237	6dmyA.pdb.gz	Structural basis for the recognition of Sonic Hedgehog by human Patched1.
13	PDB:6tbuA	0.392	0.607	1.528E-19	842	0.102	0.165	6tbuA.pdb.gz	Cryo-EM structure of the Hedgehog release protein Dispatched.
14	PDB:7n6bA	0.390	0.658	5.507E-15	757	0.082	0.148	7n6bA.pdb.gz	Structures of the mycobacterial membrane protein MmpL3 reveal its mechanism of lipid transport.
15	PDB:7e2iD	0.398	0.564	1.141E-14	907	0.103	0.154	7e2iD.pdb.gz	Structural insights into proteolytic activation of the human Dispatched1 transporter for Hedgehog morphogen release.
16	PDB:3w9iF	0.315	0.402	5.158E-13	1033	0.092	0.121	3w9iF.pdb.gz
17	PDB:7wnxA	0.406	0.706	7.915E-13	734	0.085	0.157	7wnxA.pdb.gz	Cryo-EM structure of Mycobacterium smegmatis MmpL3 complexed with ST004 in lipid nanodiscs
18	PDB:3nogA	0.298	0.385	2.985E-12	1012	0.097	0.130	3nogA.pdb.gz
19	PDB:2v50D	0.303	0.397	2.141E-11	998	0.091	0.124	2v50D.pdb.gz
20	PDB:7b5pA	0.291	0.387	3.148E-11	985	0.092	0.127	7b5pA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IZV0	914	1271	0.377	0.404	A0A0R4IZV0_DANRE Niemann-Pick C1 protein precursor OS=Danio rerio OX=7955 GN=im:7149020 PE=1 SV=2
2	A0A2R8Q2J0	906	1277	0.377	0.401	A0A2R8Q2J0_DANRE Niemann-Pick C1 protein isoform X1 OS=Danio rerio OX=7955 GN=im:7149020 PE=1 SV=1
3	A0A8I6AL97	926	1259	0.387	0.418	A0A8I6AL97_RAT NPC intracellular cholesterol transporter 1 OS=Rattus norvegicus OX=10116 GN=Npc1 PE=1 SV=1
4	A0A8I6GB30	926	1265	0.387	0.416	A0A8I6GB30_RAT NPC intracellular cholesterol transporter 1 OS=Rattus norvegicus OX=10116 GN=Npc1 PE=1 SV=1
5	A0MJA4	2181	1325	0.797	0.817	A0MJA4_CANLF Niemann-Pick C1-like 1 protein OS=Canis lupus familiaris OX=9615 GN=NPC1L1 PE=2 SV=1
6	B4DIP7	558	776	0.227	0.398	B4DIP7_HUMAN cDNA FLJ57114, highly similar to Niemann-Pick C1 protein OS=Homo sapiens OX=9606 PE=2 SV=1
7	F1QNG7	912	1276	0.380	0.404	F1QNG7_DANRE Niemann-Pick C1 protein isoform X2 OS=Danio rerio OX=7955 GN=im:7149020 PE=1 SV=1
8	F4I9G5	645	1260	0.330	0.356	F4I9G5_ARATH Patched family protein OS=Arabidopsis thaliana OX=3702 GN=ATNPC1 PE=1 SV=2
9	F4JTN1	625	1297	0.341	0.358	F4JTN1_ARATH Patched family protein OS=Arabidopsis thaliana OX=3702 GN=ATNPC1-2 PE=1 SV=1
10	G3V7K5	926	1278	0.387	0.412	G3V7K5_RAT NPC intracellular cholesterol transporter 1 OS=Rattus norvegicus OX=10116 GN=Npc1 PE=3 SV=1
11	O15118	904	1278	0.375	0.399	NPC1_HUMAN NPC intracellular cholesterol transporter 1 OS=Homo sapiens OX=9606 GN=NPC1 PE=1 SV=2
12	O35604	908	1277	0.385	0.410	NPC1_MOUSE NPC intracellular cholesterol transporter 1 OS=Mus musculus OX=10090 GN=Npc1 PE=1 SV=2
13	Q59GR1	904	1289	0.375	0.396	Q59GR1_HUMAN Niemann-Pick disease, type C1 variant (Fragment) OS=Homo sapiens OX=9606 PE=3 SV=1
14	Q5BBG1	617	1271	0.309	0.330	Q5BBG1_EMENI SSD domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02119 PE=3 SV=1
15	Q6T3U3	2030	1331	0.754	0.770	NPCL1_RAT NPC1-like intracellular cholesterol transporter 1 OS=Rattus norvegicus OX=10116 GN=Npc1l1 PE=1 SV=1
16	Q6T3U4	1975	1333	0.756	0.771	NPCL1_MOUSE NPC1-like intracellular cholesterol transporter 1 OS=Mus musculus OX=10090 GN=Npc1l1 PE=1 SV=1
17	Q7TMD4	908	1277	0.385	0.410	Q7TMD4_MOUSE Niemann Pick type C1 OS=Mus musculus OX=10090 GN=Npc1 PE=2 SV=1
18	Q7YU59	860	1287	0.366	0.386	Q7YU59_DROME RE56428p OS=Drosophila melanogaster OX=7227 GN=Npc1a PE=2 SV=1
19	Q9U5W1	861	1287	0.366	0.387	Q9U5W1_DROME NPC1 protein OS=Drosophila melanogaster OX=7227 GN=Npc1a PE=2 SV=1
20	Q9UHC9	2788	1359	1.000	1.000	NPCL1_HUMAN NPC1-like intracellular cholesterol transporter 1 OS=Homo sapiens OX=9606 GN=NPC1L1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03024 Folate_rec	33	15.8	Folate receptor family
2	PF03176 MMPL	8.9	16.7	MMPL family
3	PF16414 NPC1_N	1.6e-69	245.8	Niemann-Pick C1 N terminus
4	PF02460 Patched	1.2e-72	256.9	Patched family
5	PF12349 Sterol-sensing	7.3e-50	180.3	Sterol-sensing domain of SREBP cleavage-activation

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000289547

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000272286	0.916	ATP-binding cassette sub-family G member 8
2	9606.ENSP00000260645	0.915	ATP-binding cassette sub-family G member 5
3	9606.ENSP00000261693	0.825	Scavenger receptor class B member 1
4	9606.ENSP00000354476	0.816	Sterol regulatory element-binding protein 2
5	9606.ENSP00000451300	0.795	Protein numb homolog
6	9606.ENSP00000295522	0.788	Claudin-1
7	9606.ENSP00000301645	0.773	Cholesterol 7-alpha-monooxygenase
8	9606.ENSP00000347379	0.772	Occludin
9	9606.ENSP00000287936	0.746	3-hydroxy-3-methylglutaryl-coenzyme A reductase
10	9606.ENSP00000363868	0.741	ATP-binding cassette sub-family A member 1
11	9606.ENSP00000303208	0.736	Proprotein convertase subtilisin/kexin type 9
12	9606.ENSP00000351209	0.731	Ephrin type-A receptor 2
13	9606.ENSP00000451112	0.717	Epididymal secretory protein E1
14	9606.ENSP00000348069	0.714	Sterol regulatory element-binding protein 1
15	9606.ENSP00000427679	0.709	Microsomal triglyceride transfer protein large subunit
16	9606.ENSP00000233242	0.708	Apolipoprotein B-100
17	9606.ENSP00000275493	0.655	Epidermal growth factor receptor
18	9606.ENSP00000354995	0.649	ATP-binding cassette sub-family G member 1
19	9606.ENSP00000479606	0.644	Clathrin heavy chain 1
20	9606.ENSP00000454071	0.632	Low-density lipoprotein receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.996	heterocyclic compound binding
GO:0097159	0.988	organic cyclic compound binding
GO:0008289	0.977	lipid binding
GO:0036094	0.967	small molecule binding
GO:0005496	0.965	steroid binding
GO:0015485	0.956	cholesterol binding
GO:0005215	0.865	transporter activity
GO:0019842	0.819	vitamin binding
GO:0005319	0.814	lipid transporter activity
GO:0015248	0.751	sterol transporter activity
GO:0043167	0.744	ion binding
GO:0120020	0.711	cholesterol transfer activity
GO:0038023	0.667	signaling receptor activity
GO:0042802	0.549	identical protein binding
GO:0043168	0.544	anion binding
GO:0019899	0.400	enzyme binding
GO:0017022	0.379	myosin binding
GO:0031489	0.345	myosin V binding
GO:0046983	0.325	protein dimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051179	0.988	localization
GO:0071704	0.984	organic substance metabolic process
GO:0009987	0.981	cellular process
GO:0006810	0.976	transport
GO:0006869	0.958	lipid transport
GO:0015850	0.957	organic hydroxy compound transport
GO:0015918	0.940	sterol transport
GO:0032501	0.934	multicellular organismal process
GO:0030301	0.927	cholesterol transport
GO:0044238	0.908	primary metabolic process
GO:0065007	0.877	biological regulation
GO:0050789	0.776	regulation of biological process
GO:0051180	0.764	vitamin transport
GO:1901615	0.721	organic hydroxy compound metabolic process
GO:0007586	0.710	digestion
GO:0050896	0.704	response to stimulus
GO:0003008	0.641	system process
GO:0022600	0.615	digestive system process
GO:0006629	0.614	lipid metabolic process
GO:0050892	0.612	intestinal absorption
GO:0050794	0.601	regulation of cellular process
GO:0044237	0.498	cellular metabolic process
GO:0008202	0.498	steroid metabolic process
GO:0016125	0.456	sterol metabolic process
GO:0044281	0.329	small molecule metabolic process
GO:0006807	0.313	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:39747	0.751	cholesterol(in) = cholesterol(out)

[back to server]