StarFunc result for job id Q9UHD0

User Input

>input (177 residues)
MKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTIL
STLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQ
CQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UHD0	1.000	1.000	6.145E-25	177	1.000	1.000	Q9UHD0.pdb.gz	IL19_HUMAN Interleukin-19 OS=Homo sapiens OX=9606 GN=IL19 PE=1 SV=2
2	AFDB:Q8CJ70	0.809	0.814	1.201E-15	176	0.661	0.665	Q8CJ70.pdb.gz	IL19_MOUSE Interleukin-19 OS=Mus musculus OX=10090 GN=Il19 PE=2 SV=1
3	AFDB:Q9NYY1	0.751	0.755	9.859E-10	176	0.379	0.381	Q9NYY1.pdb.gz	IL20_HUMAN Interleukin-20 OS=Homo sapiens OX=9606 GN=IL20 PE=1 SV=2
4	PDB:4dohA	0.763	0.877	2.857E-9	153	0.356	0.412	4dohA.pdb.gz
5	AFDB:Q9JKV9	0.742	0.746	5.092E-9	176	0.339	0.341	Q9JKV9.pdb.gz	IL20_MOUSE Interleukin-20 OS=Mus musculus OX=10090 GN=Il20 PE=2 SV=1
6	AFDB:Q13007	0.649	0.566	1.520E-6	206	0.249	0.214	Q13007.pdb.gz	IL24_HUMAN Interleukin-24 OS=Homo sapiens OX=9606 GN=IL24 PE=1 SV=1
7	PDB:6df3C	0.681	0.773	3.630E-6	155	0.220	0.252	6df3C.pdb.gz
8	PDB:6gg1A	0.660	0.796	3.809E-6	145	0.249	0.303	6gg1A.pdb.gz
9	AFDB:Q925S4	0.646	0.632	1.700E-5	181	0.203	0.199	Q925S4.pdb.gz	IL24_MOUSE Interleukin-24 OS=Mus musculus OX=10090 GN=Il24 PE=2 SV=1
10	AFDB:Q9JI24	0.609	0.590	6.261E-5	183	0.215	0.208	Q9JI24.pdb.gz	IL24_RAT Interleukin-24 OS=Rattus norvegicus OX=10116 GN=Il24 PE=2 SV=1
11	AFDB:P29456	0.629	0.626	7.003E-4	178	0.153	0.152	P29456.pdb.gz	IL10_RAT Interleukin-10 OS=Rattus norvegicus OX=10116 GN=Il10 PE=2 SV=1
12	AFDB:Q5EFQ8	0.633	0.623	7.003E-4	180	0.198	0.194	Q5EFQ8.pdb.gz	Q5EFQ8_DANRE Interleukin family protein OS=Danio rerio OX=7955 GN=zgc:194510 PE=2 SV=2
13	AFDB:Q6A2H4	0.639	0.645	7.349E-4	175	0.169	0.171	Q6A2H4.pdb.gz	IL10_CHICK Interleukin-10 OS=Gallus gallus OX=9031 GN=IL10 PE=2 SV=2
14	PDB:6weoQ	0.603	0.735	1.271E-2	142	0.124	0.155	6weoQ.pdb.gz	The tissue protective functions of interleukin-22 can be decoupled from pro-inflammatory actions through structure-based design.
15	PDB:1ykbD	0.616	0.750	2.163E-2	142	0.124	0.155	1ykbD.pdb.gz	Structure of insect-cell-derived IL-22.
16	PDB:7aqsE	0.268	0.292	3.921E-1	159	0.096	0.107	7aqsE.pdb.gz	Identification of a Dps contamination in Mitomycin-C-induced expression of Colicin Ia.
17	PDB:3og6A	0.462	0.552	4.318E-1	143	0.096	0.119	3og6A.pdb.gz
18	PDB:3pvrC	0.296	0.220	5.497E-1	248	0.090	0.065	3pvrC.pdb.gz	Structural and Functional Studies of the Escherichia coli Phenylacetyl-CoA Monooxygenase Complex.
19	PDB:1lqsL	0.349	0.424	7.709E-1	142	0.147	0.183	1lqsL.pdb.gz
20	PDB:1cnt1	0.321	0.365	8.910E-1	150	0.119	0.140	1cnt1.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UHD0	7.36e-132	368	177	1.000	1.000	IL19_HUMAN Interleukin-19 OS=Homo sapiens OX=9606 GN=IL19 PE=1 SV=2
2	Q8CJ70	4.05e-83	244	176	0.672	0.676	IL19_MOUSE Interleukin-19 OS=Mus musculus OX=10090 GN=Il19 PE=2 SV=1
3	Q9JKV9	1.26e-38	132	176	0.356	0.358	IL20_MOUSE Interleukin-20 OS=Mus musculus OX=10090 GN=Il20 PE=2 SV=1
4	Q9NYY1	2.65e-32	115	176	0.395	0.398	IL20_HUMAN Interleukin-20 OS=Homo sapiens OX=9606 GN=IL20 PE=1 SV=2
5	Q13007	5.83e-15	71.6	206	0.232	0.199	IL24_HUMAN Interleukin-24 OS=Homo sapiens OX=9606 GN=IL24 PE=1 SV=1
6	Q9JI24	3.25e-14	68.9	183	0.203	0.197	IL24_RAT Interleukin-24 OS=Rattus norvegicus OX=10116 GN=Il24 PE=2 SV=1
7	Q925S4	2.92e-13	66.6	181	0.192	0.188	IL24_MOUSE Interleukin-24 OS=Mus musculus OX=10090 GN=Il24 PE=2 SV=1
8	Q6A2H4	5.02e-09	55.1	175	0.192	0.194	IL10_CHICK Interleukin-10 OS=Gallus gallus OX=9031 GN=IL10 PE=2 SV=2
9	P18893	2.23e-04	42.0	178	0.153	0.152	IL10_MOUSE Interleukin-10 OS=Mus musculus OX=10090 GN=Il10 PE=1 SV=2
10	P29456	3.01e-04	41.6	178	0.158	0.157	IL10_RAT Interleukin-10 OS=Rattus norvegicus OX=10116 GN=Il10 PE=2 SV=1
11	P22301	0.048	35.4	178	0.153	0.152	IL10_HUMAN Interleukin-10 OS=Homo sapiens OX=9606 GN=IL10 PE=1 SV=1
12	Q6FGW4	0.048	35.4	178	0.153	0.152	Q6FGW4_HUMAN Interleukin family protein OS=Homo sapiens OX=9606 GN=IL10 PE=2 SV=1
13	Q6FGS9	0.049	35.4	178	0.153	0.152	Q6FGS9_HUMAN Interleukin family protein (Fragment) OS=Homo sapiens OX=9606 GN=IL10 PE=2 SV=1
14	Q71UZ1	0.056	35.0	160	0.153	0.169	Q71UZ1_HUMAN Interleukin family protein (Fragment) OS=Homo sapiens OX=9606 GN=IL10 PE=2 SV=1
15	P03180	0.11	34.3	170	0.153	0.159	IL10H_EBVB9 Viral interleukin-10 homolog OS=Epstein-Barr virus (strain B95-8) OX=10377 GN=BCRF1 PE=1 SV=1
16	G0LWV4	0.17	33.9	173	0.130	0.133	G0LWV4_ONCMY Interleukin-22 OS=Oncorhynchus mykiss OX=8022 GN=il22 PE=2 SV=1
17	Q57YR7	0.46	33.1	2181	0.090	0.007	Q57YR7_TRYB2 acetyl-CoA carboxylase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.720 PE=4 SV=1
18	P43480	0.53	32.3	178	0.147	0.146	IL10_BOVIN Interleukin-10 OS=Bos taurus OX=9913 GN=IL10 PE=2 SV=2
19	Q29408	0.64	32.0	177	0.147	0.147	IL10_SHEEP Interleukin-10 OS=Ovis aries OX=9940 GN=IL10 PE=2 SV=1
20	Q6H8Q2	0.71	32.0	177	0.147	0.147	Q6H8Q2_SHEEP Interleukin family protein OS=Ovis aries OX=9940 GN=il10 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04312 DUF460	4.8e+02	11.8	Protein of unknown function (DUF460)
2	PF00726 IL10	5.6e-05	34.2	Interleukin 10
3	PF14565 IL22	62	15.3	Interleukin 22 IL-10-related T-cell-derived-inducible factor
4	PF02854 MIF4G	1.2e+02	13.7	MIF4G domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343000

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000314976	0.997	Interleukin-20 receptor subunit alpha
2	9606.ENSP00000328133	0.982	Interleukin-20 receptor subunit beta
3	9606.ENSP00000270800	0.892	Interleukin-22 receptor subunit alpha-1
4	9606.ENSP00000290200	0.863	Interleukin-10 receptor subunit beta
5	9606.ENSP00000375795	0.856	Interleukin-24
6	9606.ENSP00000356065	0.821	Interleukin-20
7	9606.ENSP00000229134	0.805	Interleukin-26
8	9606.ENSP00000227752	0.797	Interleukin-10 receptor subunit alpha
9	9606.ENSP00000264657	0.778	Signal transducer and activator of transcription 3
10	9606.ENSP00000296980	0.770	Interleukin-22 receptor subunit alpha-2
11	9606.ENSP00000343204	0.746	Tyrosine-protein kinase JAK1
12	9606.ENSP00000327824	0.745	Interferon lambda receptor 1
13	9606.ENSP00000361004	0.743	Interleukin-13 receptor subunit alpha-2
14	9606.ENSP00000379111	0.722	Interleukin-4 receptor subunit alpha
15	9606.ENSP00000321345	0.718	Interleukin-23 receptor
16	9606.ENSP00000360730	0.717	Interleukin-13 receptor subunit alpha-1
17	9606.ENSP00000412237	0.717	Interleukin-10
18	9606.ENSP00000470788	0.691	Interleukin-12 receptor subunit beta-1
19	9606.ENSP00000338010	0.687	Interleukin-21 receptor
20	9606.ENSP00000362195	0.685	Granulocyte colony-stimulating factor receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005125	1.000	cytokine activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.990	regulation of cellular process
GO:0048518	0.987	positive regulation of biological process
GO:0048522	0.926	positive regulation of cellular process
GO:0009987	0.925	cellular process
GO:0051239	0.837	regulation of multicellular organismal process
GO:0019222	0.804	regulation of metabolic process
GO:0048583	0.728	regulation of response to stimulus
GO:0048519	0.660	negative regulation of biological process
GO:0023051	0.563	regulation of signaling
GO:0010646	0.563	regulation of cell communication
GO:0009966	0.544	regulation of signal transduction
GO:0050896	0.530	response to stimulus
GO:0048523	0.510	negative regulation of cellular process
GO:0060255	0.481	regulation of macromolecule metabolic process
GO:0031323	0.444	regulation of cellular metabolic process
GO:0010604	0.439	positive regulation of macromolecule metabolic process
GO:0048584	0.421	positive regulation of response to stimulus
GO:0080090	0.411	regulation of primary metabolic process
GO:0010647	0.410	positive regulation of cell communication
GO:0023056	0.408	positive regulation of signaling
GO:0009967	0.402	positive regulation of signal transduction
GO:0051171	0.329	regulation of nitrogen compound metabolic process
GO:0010468	0.315	regulation of gene expression
GO:0031325	0.305	positive regulation of cellular metabolic process
GO:0042127	0.302	regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0016020	0.464	membrane
GO:0071944	0.439	cell periphery
GO:0005615	0.301	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]