StarFunc result for job id Q9UHD1

User Input

>input (332 residues)
MALLCYNRGCGQRFDPETNSDDACTYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIVGCT
KGRHNSEKPPEPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAIKRPSPDEPMTNLEL
KISASLKQALDKLKLSSGNEENKKEEDNDEIKIGTSCKNGGCSKTYQGLESLEEVCVYHS
GVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVPCRHDWHQTGGE
VTISVYAKNSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKI
EITMRKAEPMQWASLELPAAKKQEKQKDATTD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UHD1	1.000	1.000	7.262E-66	332	1.000	1.000	Q9UHD1.pdb.gz	CHRD1_HUMAN Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1 PE=1 SV=2
2	AFDB:Q9R000	0.402	0.382	1.907E-38	350	0.473	0.449	Q9R000.pdb.gz	ITBP2_MOUSE Integrin beta-1-binding protein 2 OS=Mus musculus OX=10090 GN=Itgb1bp2 PE=1 SV=1
3	AFDB:Q9VCC0	0.501	0.474	7.282E-38	354	0.431	0.404	Q9VCC0.pdb.gz	CHRD1_DROME Cysteine and histidine-rich domain-containing protein morgana OS=Drosophila melanogaster OX=7227 GN=mora PE=1 SV=1
4	AFDB:C8VTA5	0.222	0.333	5.221E-14	209	0.232	0.368	C8VTA5.pdb.gz	C8VTA5_EMENI ChpADiploid state maintenance protein chpA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10148 PE=4 SV=1
5	AFDB:Q6EPW7	0.206	0.288	6.173E-14	233	0.208	0.296	Q6EPW7.pdb.gz	RAR1_ORYSJ Cysteine and histidine-rich domain-containing protein RAR1 OS=Oryza sativa subsp. japonica OX=39947 GN=RAR1 PE=1 SV=2
6	AFDB:Q9SE33	0.218	0.312	1.859E-12	226	0.202	0.296	Q9SE33.pdb.gz	RAR1_ARATH Cysteine and histidine-rich domain-containing protein RAR1 OS=Arabidopsis thaliana OX=3702 GN=RAR1 PE=1 SV=1
7	AFDB:Q4GYQ6	0.214	0.228	5.370E-12	305	0.175	0.190	Q4GYQ6.pdb.gz	Q4GYQ6_TRYB2 CHORD domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3170 PE=4 SV=1
8	AFDB:A0A1D8PIG5	0.280	0.227	1.427E-9	413	0.120	0.097	A0A1D8PIG5.pdb.gz	A0A1D8PIG5_CANAL Co-chaperone OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SGT1 PE=3 SV=1
9	AFDB:Q9SUR9	0.260	0.247	5.760E-9	350	0.102	0.097	Q9SUR9.pdb.gz	SGT1A_ARATH Protein SGT1 homolog A OS=Arabidopsis thaliana OX=3702 GN=SGT1A PE=1 SV=1
10	AFDB:Q9Y2Z0	0.265	0.241	6.090E-9	365	0.087	0.079	Q9Y2Z0.pdb.gz	SGT1_HUMAN Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1 PE=1 SV=3
11	PDB:7krjC	0.261	0.635	5.940E-7	133	0.060	0.150	7krjC.pdb.gz	Structure of Hsp90-p23-GR reveals the Hsp90 client-remodelling mechanism.
12	PDB:3w1zB	0.220	0.485	2.501E-5	143	0.063	0.147	3w1zB.pdb.gz
13	PDB:2kmwA	0.234	0.484	3.646E-4	150	0.051	0.113	2kmwA.pdb.gz
14	PDB:1gmeA	0.217	0.458	4.820E-4	150	0.051	0.113	1gmeA.pdb.gz
15	PDB:1shsA	0.222	0.607	6.737E-4	115	0.036	0.104	1shsA.pdb.gz
16	PDB:4ylbA	0.208	0.503	1.472E-3	128	0.042	0.109	4ylbA.pdb.gz
17	PDB:4ydzA	0.210	0.464	2.433E-3	135	0.039	0.096	4ydzA.pdb.gz
18	PDB:6f2rA	0.197	0.460	4.753E-3	130	0.036	0.092	6f2rA.pdb.gz	Terminal Regions Confer Plasticity to the Tetrameric Assembly of Human HspB2 and HspB3.
19	PDB:4zjaA	0.202	0.558	8.784E-3	106	0.033	0.104	4zjaA.pdb.gz
20	PDB:7oa6B	0.206	0.415	1.623E-2	152	0.045	0.099	7oa6B.pdb.gz	Phosphorylation activates the yeast small heat shock protein Hsp26 by weakening domain contacts in the oligomer ensemble.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9D1P4	0.0	662	331	0.952	0.955	CHRD1_MOUSE Cysteine and histidine-rich domain-containing protein 1 OS=Mus musculus OX=10090 GN=Chordc1 PE=1 SV=1
2	Q9UHD1	0.0	692	332	1.000	1.000	CHRD1_HUMAN Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1 PE=1 SV=2
3	D3ZW59	1.40e-103	309	349	0.476	0.453	D3ZW59_RAT Integrin subunit beta 1 binding protein 2 OS=Rattus norvegicus OX=10116 GN=Itgb1bp2 PE=4 SV=1
4	Q9R000	1.66e-103	309	350	0.461	0.437	ITBP2_MOUSE Integrin beta-1-binding protein 2 OS=Mus musculus OX=10090 GN=Itgb1bp2 PE=1 SV=1
5	Q9UKP3	2.51e-101	303	347	0.464	0.444	ITBP2_HUMAN Integrin beta-1-binding protein 2 OS=Homo sapiens OX=9606 GN=ITGB1BP2 PE=1 SV=1
6	Q9VCC0	1.06e-100	302	354	0.419	0.393	CHRD1_DROME Cysteine and histidine-rich domain-containing protein morgana OS=Drosophila melanogaster OX=7227 GN=mora PE=1 SV=1
7	A0A8I6A523	8.09e-88	268	328	0.440	0.445	A0A8I6A523_RAT Integrin subunit beta 1 binding protein 2 OS=Rattus norvegicus OX=10116 GN=Itgb1bp2 PE=4 SV=1
8	C8VTA5	5.89e-35	128	209	0.232	0.368	C8VTA5_EMENI ChpADiploid state maintenance protein chpA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10148 PE=4 SV=1
9	Q6EPW7	1.28e-29	115	233	0.217	0.309	RAR1_ORYSJ Cysteine and histidine-rich domain-containing protein RAR1 OS=Oryza sativa subsp. japonica OX=39947 GN=RAR1 PE=1 SV=2
10	Q9SE33	2.25e-26	106	226	0.217	0.319	RAR1_ARATH Cysteine and histidine-rich domain-containing protein RAR1 OS=Arabidopsis thaliana OX=3702 GN=RAR1 PE=1 SV=1
11	Q4GYQ6	2.68e-23	99.8	305	0.181	0.197	Q4GYQ6_TRYB2 CHORD domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3170 PE=4 SV=1
12	Q9SUT5	5.48e-07	53.1	358	0.087	0.081	SGT1B_ARATH Protein SGT1 homolog B OS=Arabidopsis thaliana OX=3702 GN=SGT1B PE=1 SV=1
13	Q0JL44	8.95e-07	52.4	367	0.090	0.082	SGT1_ORYSJ Protein SGT1 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=SGT1 PE=1 SV=1
14	Q8SY87	1.65e-06	50.1	178	0.093	0.174	Q8SY87_DROME RH27607p OS=Drosophila melanogaster OX=7227 GN=Sgt1 PE=2 SV=1
15	Q9VHT3	1.65e-06	50.1	178	0.093	0.174	Q9VHT3_DROME CG9617 protein OS=Drosophila melanogaster OX=7227 GN=Sgt1 PE=1 SV=1
16	Q9SUR9	4.24e-06	50.1	350	0.084	0.080	SGT1A_ARATH Protein SGT1 homolog A OS=Arabidopsis thaliana OX=3702 GN=SGT1A PE=1 SV=1
17	A0A1D8PIG5	3.26e-04	44.7	413	0.093	0.075	A0A1D8PIG5_CANAL Co-chaperone OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SGT1 PE=3 SV=1
18	Q9Y2Z0	7.35e-04	43.1	365	0.072	0.066	SGT1_HUMAN Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1 PE=1 SV=3
19	Q08446	0.001	43.1	395	0.096	0.081	SGT1_YEAST Protein SGT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SGT1 PE=1 SV=1
20	Q4GYQ3	0.001	42.4	221	0.075	0.113	Q4GYQ3_TRYB2 Phosphatase-like protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3200 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04968 CHORD	3e-52	186.3	CHORD
2	PF04969 CS	2.6e-11	55.7	CS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000319255

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000335153	0.992	Heat shock protein HSP 90-alpha
2	9606.ENSP00000367208	0.953	Protein SGT1 homolog
3	9606.ENSP00000360609	0.896	Heat shock protein HSP 90-beta
4	9606.ENSP00000012443	0.811	Serine/threonine-protein phosphatase 5
5	9606.ENSP00000318687	0.782	Heat shock protein 105 kDa
6	9606.ENSP00000356652	0.775	Calcyclin-binding protein
7	9606.ENSP00000216479	0.741	Activator of 90 kDa heat shock protein ATPase homolog 1
8	9606.ENSP00000309175	0.736	Probable RNA-binding protein EIF1AD
9	9606.ENSP00000240651	0.730	Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 1
10	9606.ENSP00000357440	0.713	Heat shock factor protein 2
11	9606.ENSP00000368140	0.711	Cardiolipin synthase (CMP-forming)
12	9606.ENSP00000359607	0.706	Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2
13	9606.ENSP00000360329	0.696	Tetratricopeptide repeat domain containing
14	9606.ENSP00000359518	0.694	MRG/MORF4L-binding protein
15	9606.ENSP00000299767	0.692	Endoplasmin
16	9606.ENSP00000254928	0.690	GTPase Era, mitochondrial
17	9606.ENSP00000312599	0.684	Transmembrane protein 70, mitochondrial
18	9606.ENSP00000349244	0.683	Erythroid differentiation-related factor 1
19	9606.ENSP00000398596	0.681	Phosphatidate cytidylyltransferase, mitochondrial
20	9606.ENSP00000471730	0.676	Protein PPP5D1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0031072	0.977	heat shock protein binding
GO:0051879	0.973	Hsp90 protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0032886	0.995	regulation of microtubule-based process
GO:0051128	0.993	regulation of cellular component organization
GO:0051246	0.985	regulation of protein metabolic process
GO:0048523	0.976	negative regulation of cellular process
GO:0051174	0.975	regulation of phosphorus metabolic process
GO:0031399	0.971	regulation of protein modification process
GO:0006457	0.968	protein folding
GO:0048583	0.961	regulation of response to stimulus
GO:0050790	0.954	regulation of catalytic activity
GO:0042325	0.952	regulation of phosphorylation
GO:0051338	0.914	regulation of transferase activity
GO:0045859	0.904	regulation of protein kinase activity
GO:0051172	0.885	negative regulation of nitrogen compound metabolic process
GO:0046605	0.883	regulation of centrosome cycle
GO:0031400	0.869	negative regulation of protein modification process
GO:0071900	0.869	regulation of protein serine/threonine kinase activity
GO:0010563	0.865	negative regulation of phosphorus metabolic process
GO:0001933	0.857	negative regulation of protein phosphorylation
GO:0051348	0.844	negative regulation of transferase activity
GO:0033673	0.833	negative regulation of kinase activity
GO:0006469	0.813	negative regulation of protein kinase activity
GO:0080134	0.728	regulation of response to stress
GO:0010824	0.722	regulation of centrosome duplication
GO:0071901	0.583	negative regulation of protein serine/threonine kinase activity
GO:0061077	0.551	chaperone-mediated protein folding
GO:0048518	0.426	positive regulation of biological process
GO:0048522	0.377	positive regulation of cellular process
GO:0050896	0.340	response to stimulus
GO:0071840	0.326	cellular component organization or biogenesis
GO:0016043	0.305	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0043232	0.986	intracellular non-membrane-bounded organelle
GO:0070013	0.969	intracellular organelle lumen
GO:0005829	0.961	cytosol
GO:0005634	0.934	nucleus
GO:0099080	0.821	supramolecular complex
GO:0005856	0.681	cytoskeleton
GO:0099081	0.593	supramolecular polymer
GO:0099512	0.572	supramolecular fiber
GO:0015630	0.446	microtubule cytoskeleton
GO:0031981	0.336	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]