StarFunc result for job id Q9UHD2

User Input

>input (729 residues)
MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLK
KLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVV
GGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYL
HPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITG
KPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFA
ETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLV
LEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITG
VVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVK
VYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQE
GTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTH
FTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQ
KMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMD
GGLRNVDCL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6o8bB	0.876	0.971	0.000	657	0.886	0.983	6o8bB.pdb.gz	A conserved PLPLRT/SD motif of STING mediates the recruitment and activation of TBK1.
2	AFDB:A7UNK0	0.920	0.920	0.000	729	0.964	0.964	A7UNK0.pdb.gz
3	AFDB:Q0GKD6	0.947	0.950	1.750E-103	727	0.711	0.713	Q0GKD6.pdb.gz	Q0GKD6_DANRE Serine/threonine-protein kinase TBK1 OS=Danio rerio OX=7955 GN=wu:fk70c05 PE=1 SV=1
4	AFDB:A0A494C0X2	0.774	0.876	3.123E-103	643	0.881	0.998	A0A494C0X2.pdb.gz	A0A494C0X2_HUMAN TANK binding kinase 1 OS=Homo sapiens OX=9606 GN=TBK1 PE=1 SV=1
5	PDB:4im0A	0.822	0.967	2.237E-98	619	0.833	0.981	4im0A.pdb.gz	Structure and ubiquitination-dependent activation of TANK-binding kinase 1.
6	PDB:6o8cA	0.823	0.942	1.849E-93	636	0.804	0.921	6o8cA.pdb.gz	A conserved PLPLRT/SD motif of STING mediates the recruitment and activation of TBK1.
7	AFDB:Q9R0T8	0.893	0.908	5.472E-79	717	0.466	0.474	Q9R0T8.pdb.gz	IKKE_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Mus musculus OX=10090 GN=Ikbke PE=1 SV=2
8	AFDB:Q14164	0.866	0.881	5.768E-79	716	0.487	0.496	Q14164.pdb.gz	IKKE_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Homo sapiens OX=9606 GN=IKBKE PE=1 SV=1
9	AFDB:Q86PE7	0.845	0.855	1.514E-66	720	0.362	0.367	Q86PE7.pdb.gz	Q86PE7_DROME SD10041p OS=Drosophila melanogaster OX=7227 GN=IKKepsilon PE=1 SV=1
10	AFDB:Q1JPV3	0.425	0.844	1.957E-52	365	0.374	0.748	Q1JPV3.pdb.gz
11	AFDB:B0R199	0.514	0.485	5.741E-36	779	0.219	0.205	B0R199.pdb.gz
12	AFDB:O88351	0.511	0.495	2.644E-35	757	0.218	0.210	O88351.pdb.gz	IKKB_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Mus musculus OX=10090 GN=Ikbkb PE=1 SV=1
13	AFDB:Q4G3H4	0.500	0.484	5.243E-35	758	0.214	0.206	Q4G3H4.pdb.gz	IKKA_DANRE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Danio rerio OX=7955 GN=chuk PE=1 SV=1
14	PDB:5u6yA	0.314	0.485	1.188E-15	459	0.095	0.150	5u6yA.pdb.gz
15	PDB:4zhxA	0.319	0.553	7.506E-15	409	0.097	0.174	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
16	PDB:4krcA	0.324	0.743	1.085E-14	297	0.103	0.253	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
17	PDB:6b1uA	0.322	0.520	1.085E-14	442	0.096	0.158	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
18	PDB:5ufuA	0.319	0.608	1.654E-14	369	0.093	0.184	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
19	PDB:3c4wB	0.300	0.413	2.042E-14	519	0.097	0.137	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
20	PDB:6byrA	0.302	0.527	2.952E-14	405	0.100	0.180	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A494C0X2	0.0	1325	643	0.882	1.000	A0A494C0X2_HUMAN TANK binding kinase 1 OS=Homo sapiens OX=9606 GN=TBK1 PE=1 SV=1
2	A0A494C148	0.0	1460	705	0.967	1.000	A0A494C148_HUMAN TANK binding kinase 1 OS=Homo sapiens OX=9606 GN=TBK1 PE=1 SV=1
3	A0A494C167	0.0	1411	677	0.929	1.000	A0A494C167_HUMAN TANK binding kinase 1 OS=Homo sapiens OX=9606 GN=TBK1 PE=1 SV=1
4	Q0GKD6	0.0	1088	727	0.712	0.714	Q0GKD6_DANRE Serine/threonine-protein kinase TBK1 OS=Danio rerio OX=7955 GN=wu:fk70c05 PE=1 SV=1
5	Q14164	0.0	678	716	0.481	0.490	IKKE_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Homo sapiens OX=9606 GN=IKBKE PE=1 SV=1
6	Q9R0T8	0.0	658	717	0.466	0.474	IKKE_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Mus musculus OX=10090 GN=Ikbke PE=1 SV=2
7	Q9UHD2	0.0	1521	729	1.000	1.000	TBK1_HUMAN Serine/threonine-protein kinase TBK1 OS=Homo sapiens OX=9606 GN=TBK1 PE=1 SV=1
8	Q9WUN2	0.0	1459	729	0.941	0.941	TBK1_MOUSE Serine/threonine-protein kinase TBK1 OS=Mus musculus OX=10090 GN=Tbk1 PE=1 SV=1
9	Q86PE7	5.23e-158	476	720	0.355	0.360	Q86PE7_DROME SD10041p OS=Drosophila melanogaster OX=7227 GN=IKKepsilon PE=1 SV=1
10	Q9V3Y8	1.57e-157	475	720	0.354	0.358	Q9V3Y8_DROME FI05319p OS=Drosophila melanogaster OX=7227 GN=IKKepsilon PE=2 SV=2
11	Q7KJQ4	5.83e-152	460	711	0.348	0.357	Q7KJQ4_DROME Protein kinase DIK2 OS=Drosophila melanogaster OX=7227 GN=IKKepsilon PE=2 SV=1
12	Q5ZJB4	6.21e-36	147	759	0.148	0.142	IKKA_CHICK Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Gallus gallus OX=9031 GN=CHUK PE=2 SV=1
13	Q4G3H4	3.57e-35	145	758	0.148	0.142	IKKA_DANRE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Danio rerio OX=7955 GN=chuk PE=1 SV=1
14	Q9QY78	1.12e-33	140	757	0.147	0.141	IKKB_RAT Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Rattus norvegicus OX=10116 GN=Ikbkb PE=1 SV=1
15	O88351	1.13e-33	140	757	0.144	0.139	IKKB_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Mus musculus OX=10090 GN=Ikbkb PE=1 SV=1
16	O14920	6.72e-33	138	756	0.143	0.138	IKKB_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Homo sapiens OX=9606 GN=IKBKB PE=1 SV=1
17	Q60680	1.37e-30	130	745	0.144	0.141	IKKA_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Mus musculus OX=10090 GN=Chuk PE=1 SV=1
18	O15111	2.52e-30	130	745	0.152	0.149	IKKA_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Homo sapiens OX=9606 GN=CHUK PE=1 SV=2
19	G3V926	5.91e-30	128	680	0.144	0.154	G3V926_RAT IkappaB kinase OS=Rattus norvegicus OX=10116 GN=Chuk PE=4 SV=2
20	A0A8I6ANR6	6.92e-30	128	713	0.144	0.147	A0A8I6ANR6_RAT IkappaB kinase OS=Rattus norvegicus OX=10116 GN=Chuk PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.47	21.1	ABC1 atypical kinase-like domain
2	PF17045 CEP63	17	16.7	Centrosomal protein of 63 kDa
3	PF05218 DUF713	3.7	18.8	Protein of unknown function (DUF713)
4	PF14531 Kinase-like	2.8	18.8	Kinase-like
5	PF05531 NPV_P10	6.8e+02	12.1	Nucleopolyhedrovirus P10 protein
6	PF00069 Pkinase	9.7e-42	154.7	Protein kinase domain
7	PF17667 Pkinase_fungal	0.0067	26.9	Fungal protein kinase
8	PF07714 PK_Tyr_Ser-Thr	3.6e-22	90.5	Protein tyrosine and serine/threonine kinase
9	PF18394 TBK1_CCD1	3.1e-118	405.5	TANK-binding kinase 1 coiled-coil domain 1
10	PF18396 TBK1_ULD	3.1e-33	124.8	TANK binding kinase 1 ubiquitin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329967

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331288	0.999	Stimulator of interferon genes protein
2	9606.ENSP00000368022	0.999	Optineurin
3	9606.ENSP00000376505	0.999	TRAF family member-associated NF-kappa-B activator
4	9606.ENSP00000401980	0.999	Mitochondrial antiviral-signaling protein
5	9606.ENSP00000454207	0.999	TNF receptor-associated factor 3
6	9606.ENSP00000471896	0.999	Interferon regulatory factor 3
7	9606.ENSP00000483825	0.999	NF-kappa-B essential modulator
8	9606.ENSP00000354777	0.998	TANK-binding kinase 1-binding protein 1
9	9606.ENSP00000382840	0.998	ATP-dependent RNA helicase DDX3X
10	9606.ENSP00000230449	0.997	Exocyst complex component 2
11	9606.ENSP00000398523	0.997	Calcium-binding and coiled-coil domain-containing protein 2
12	9606.ENSP00000248244	0.995	TIR domain-containing adapter molecule 1
13	9606.ENSP00000419371	0.993	5-azacytidine-induced protein 2
14	9606.ENSP00000433623	0.988	TNF receptor-associated factor 6
15	9606.ENSP00000464030	0.987	Inhibitor of nuclear factor kappa-B kinase subunit epsilon
16	9606.ENSP00000369213	0.983	Probable ATP-dependent RNA helicase DDX58
17	9606.ENSP00000296795	0.982	Toll-like receptor 3
18	9606.ENSP00000380697	0.982	Interferon regulatory factor 7
19	9606.ENSP00000247668	0.981	TNF receptor-associated factor 2
20	9606.ENSP00000374455	0.978	Sequestosome-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0019899	0.782	enzyme binding
GO:0051219	0.566	phosphoprotein binding
GO:1901363	0.477	heterocyclic compound binding
GO:0097159	0.474	organic cyclic compound binding
GO:0042802	0.465	identical protein binding
GO:0003676	0.313	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0048518	0.996	positive regulation of biological process
GO:0019222	0.996	regulation of metabolic process
GO:0048583	0.995	regulation of response to stimulus
GO:0006950	0.991	response to stress
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0009893	0.986	positive regulation of metabolic process
GO:0048522	0.984	positive regulation of cellular process
GO:0031323	0.984	regulation of cellular metabolic process
GO:0010468	0.984	regulation of gene expression
GO:0006807	0.983	nitrogen compound metabolic process
GO:0043170	0.980	macromolecule metabolic process
GO:0044238	0.979	primary metabolic process
GO:0044237	0.974	cellular metabolic process
GO:0010604	0.969	positive regulation of macromolecule metabolic process
GO:0036211	0.968	protein modification process
GO:0044419	0.967	biological process involved in interspecies interaction between organisms
GO:0009607	0.967	response to biotic stimulus
GO:0032648	0.967	regulation of interferon-beta production
GO:0048584	0.964	positive regulation of response to stimulus
GO:0018209	0.960	peptidyl-serine modification
GO:0016310	0.957	phosphorylation
GO:0009605	0.956	response to external stimulus
GO:0009966	0.956	regulation of signal transduction
GO:0018105	0.954	peptidyl-serine phosphorylation
GO:0032481	0.952	positive regulation of type I interferon production
GO:0009894	0.948	regulation of catabolic process
GO:0002376	0.946	immune system process
GO:0051707	0.939	response to other organism
GO:0010506	0.939	regulation of autophagy
GO:0032728	0.938	positive regulation of interferon-beta production
GO:0009967	0.930	positive regulation of signal transduction
GO:0006952	0.917	defense response
GO:0031325	0.905	positive regulation of cellular metabolic process
GO:0051716	0.888	cellular response to stimulus
GO:0098542	0.885	defense response to other organism
GO:0080090	0.870	regulation of primary metabolic process
GO:0007154	0.869	cell communication
GO:0051171	0.863	regulation of nitrogen compound metabolic process
GO:0007165	0.860	signal transduction
GO:0031326	0.830	regulation of cellular biosynthetic process
GO:0031331	0.830	positive regulation of cellular catabolic process
GO:0045087	0.811	innate immune response
GO:0010508	0.807	positive regulation of autophagy
GO:1902533	0.784	positive regulation of intracellular signal transduction
GO:0016241	0.760	regulation of macroautophagy
GO:0048519	0.753	negative regulation of biological process
GO:0060759	0.749	regulation of response to cytokine stimulus
GO:0019219	0.741	regulation of nucleobase-containing compound metabolic process
GO:0080134	0.720	regulation of response to stress
GO:0051252	0.710	regulation of RNA metabolic process
GO:0016239	0.670	positive regulation of macroautophagy
GO:0002682	0.659	regulation of immune system process
GO:0031347	0.654	regulation of defense response
GO:0051173	0.612	positive regulation of nitrogen compound metabolic process
GO:0006355	0.605	regulation of DNA-templated transcription
GO:0002684	0.528	positive regulation of immune system process
GO:0043122	0.526	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0032101	0.519	regulation of response to external stimulus
GO:0042221	0.490	response to chemical
GO:0035556	0.433	intracellular signal transduction
GO:0010033	0.425	response to organic substance
GO:0031349	0.418	positive regulation of defense response
GO:0045088	0.416	regulation of innate immune response
GO:0048523	0.415	negative regulation of cellular process
GO:0065009	0.411	regulation of molecular function
GO:0050778	0.393	positive regulation of immune response
GO:0009615	0.382	response to virus
GO:0070887	0.368	cellular response to chemical stimulus
GO:0051246	0.360	regulation of protein metabolic process
GO:0032103	0.353	positive regulation of response to external stimulus
GO:0043123	0.335	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0009892	0.334	negative regulation of metabolic process
GO:0045089	0.332	positive regulation of innate immune response
GO:0010605	0.321	negative regulation of macromolecule metabolic process
GO:0045935	0.313	positive regulation of nucleobase-containing compound metabolic process
GO:0044093	0.304	positive regulation of molecular function
GO:0060760	0.304	positive regulation of response to cytokine stimulus
GO:0051254	0.304	positive regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005654	0.992	nucleoplasm
GO:0005829	0.973	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]