StarFunc result for job id Q9UHD9

User Input

>input (624 residues)
MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEA
ISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQGQSTQPSNAAG
TNTTSASTPRSNSTPISTNSNPFGLGSLGGLAGLSSLGLSSTNFSELQSQMQQQLMASPE
MMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHLLNNPDIMRQTLEIARN
PAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASVGSSSS
SGEGTQPSRTENRDPLPNPWAPPPATQSSATTSTTTSTGSGSGNSSSNATGNTVAAANYV
ASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDLAAQMMLNSPLFTANP
QLQEQMRPQLPAFLQQMQNPDTLSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGV
GVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAAPPGSTGSGGPTGPTVSS
AAPSETTSPTSESGPNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREAN
LQALIATGGDINAAIERLLGSQPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UHD9	1.000	1.000	7.867E-91	624	1.000	1.000	Q9UHD9.pdb.gz	UBQL2_HUMAN Ubiquilin-2 OS=Homo sapiens OX=9606 GN=UBQLN2 PE=1 SV=2
2	AFDB:D4AA63	0.465	0.457	1.841E-77	638	0.885	0.865	D4AA63.pdb.gz	D4AA63_RAT Ubiquilin 2 OS=Rattus norvegicus OX=10116 GN=Ubqln2 PE=4 SV=1
3	AFDB:Q9UMX0	0.410	0.428	3.164E-66	589	0.753	0.798	Q9UMX0.pdb.gz	UBQL1_HUMAN Ubiquilin-1 OS=Homo sapiens OX=9606 GN=UBQLN1 PE=1 SV=2
4	AFDB:Q9JJP9	0.541	0.574	5.112E-65	582	0.724	0.777	Q9JJP9.pdb.gz	UBQL1_RAT Ubiquilin-1 OS=Rattus norvegicus OX=10116 GN=Ubqln1 PE=1 SV=1
5	AFDB:A0A024R258	0.214	0.234	1.451E-58	561	0.718	0.799	A0A024R258.pdb.gz
6	AFDB:Q9NRR5	0.354	0.365	1.196E-51	601	0.574	0.596	Q9NRR5.pdb.gz	UBQL4_HUMAN Ubiquilin-4 OS=Homo sapiens OX=9606 GN=UBQLN4 PE=1 SV=2
7	AFDB:Q9VWD9	0.316	0.348	2.843E-45	547	0.442	0.505	Q9VWD9.pdb.gz	Q9VWD9_DROME LD38919p OS=Drosophila melanogaster OX=7227 GN=Ubqn PE=1 SV=1
8	AFDB:Q9SII8	0.202	0.223	2.379E-26	551	0.301	0.341	Q9SII8.pdb.gz	DSK2B_ARATH Ubiquitin domain-containing protein DSK2b OS=Arabidopsis thaliana OX=3702 GN=DSK2B PE=1 SV=1
9	AFDB:Q9NIF3	0.158	0.185	2.393E-25	523	0.309	0.369	Q9NIF3.pdb.gz	UBQL_DICDI Ubiquilin OS=Dictyostelium discoideum OX=44689 GN=ubqln PE=1 SV=1
10	AFDB:Q9D4I8	0.140	0.169	2.652E-18	510	0.279	0.341	Q9D4I8.pdb.gz	Q9D4I8_MOUSE Ubiquilin 5 OS=Mus musculus OX=10090 GN=Ubqln5 PE=1 SV=1
11	PDB:7rbsB	0.122	0.467	5.704E-7	157	0.030	0.121	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
12	PDB:4pyuA	0.118	0.914	8.633E-7	76	0.026	0.211	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
13	PDB:6yvaC	0.121	0.471	1.386E-6	155	0.026	0.103	6yvaC.pdb.gz
14	PDB:3plvA	0.115	0.865	2.362E-6	80	0.032	0.250	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
15	PDB:6mdhA	0.116	0.472	3.369E-6	149	0.026	0.107	6mdhA.pdb.gz
16	PDB:5xqmA	0.115	0.710	5.099E-6	90	0.029	0.200	5xqmA.pdb.gz
17	PDB:3dbhI	0.124	0.820	5.410E-6	86	0.032	0.233	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
18	PDB:3ai5A	0.113	0.233	9.217E-6	299	0.037	0.077	3ai5A.pdb.gz
19	PDB:3tixA	0.114	0.440	1.480E-5	153	0.022	0.092	3tixA.pdb.gz
20	PDB:6ef3u	0.114	0.865	3.816E-5	75	0.037	0.307	6ef3u.pdb.gz	Substrate-engaged 26Sproteasome structures reveal mechanisms for ATP-hydrolysis-driven translocation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A287B231	0.0	633	561	0.593	0.660	A0A287B231_PIG Ubiquilin 1 OS=Sus scrofa OX=9823 GN=UBQLN1 PE=1 SV=2
2	D4AA63	0.0	898	638	0.873	0.854	D4AA63_RAT Ubiquilin 2 OS=Rattus norvegicus OX=10116 GN=Ubqln2 PE=4 SV=1
3	Q8R317	0.0	795	582	0.740	0.794	UBQL1_MOUSE Ubiquilin-1 OS=Mus musculus OX=10090 GN=Ubqln1 PE=1 SV=1
4	Q99NB8	0.0	578	596	0.562	0.589	UBQL4_MOUSE Ubiquilin-4 OS=Mus musculus OX=10090 GN=Ubqln4 PE=1 SV=1
5	Q9JJP9	0.0	803	582	0.737	0.790	UBQL1_RAT Ubiquilin-1 OS=Rattus norvegicus OX=10116 GN=Ubqln1 PE=1 SV=1
6	Q9NRR5	0.0	574	601	0.569	0.591	UBQL4_HUMAN Ubiquilin-4 OS=Homo sapiens OX=9606 GN=UBQLN4 PE=1 SV=2
7	Q9QZM0	0.0	707	638	0.671	0.657	UBQL2_MOUSE Ubiquilin-2 OS=Mus musculus OX=10090 GN=Ubqln2 PE=1 SV=2
8	Q9UHD9	0.0	1226	624	1.000	1.000	UBQL2_HUMAN Ubiquilin-2 OS=Homo sapiens OX=9606 GN=UBQLN2 PE=1 SV=2
9	Q9UMX0	0.0	808	589	0.758	0.803	UBQL1_HUMAN Ubiquilin-1 OS=Homo sapiens OX=9606 GN=UBQLN1 PE=1 SV=2
10	Q9VWD9	1.95e-147	439	547	0.354	0.404	Q9VWD9_DROME LD38919p OS=Drosophila melanogaster OX=7227 GN=Ubqn PE=1 SV=1
11	Q9H347	1.36e-110	348	655	0.303	0.289	UBQL3_HUMAN Ubiquilin-3 OS=Homo sapiens OX=9606 GN=UBQLN3 PE=1 SV=2
12	G5EFF7	6.57e-97	308	502	0.330	0.410	UBQL_CAEEL Ubiquilin OS=Caenorhabditis elegans OX=6239 GN=ubql-1 PE=2 SV=1
13	Q8IYU4	6.35e-60	209	475	0.272	0.358	UBQLN_HUMAN Ubiquilin-like protein OS=Homo sapiens OX=9606 GN=UBQLNL PE=1 SV=3
14	Q9SII8	9.48e-60	211	551	0.256	0.290	DSK2B_ARATH Ubiquitin domain-containing protein DSK2b OS=Arabidopsis thaliana OX=3702 GN=DSK2B PE=1 SV=1
15	Q9SII9	4.99e-58	206	538	0.264	0.307	DSK2A_ARATH Ubiquitin domain-containing protein DSK2a OS=Arabidopsis thaliana OX=3702 GN=DSK2A PE=1 SV=2
16	Q9D4I8	2.18e-53	192	510	0.293	0.359	Q9D4I8_MOUSE Ubiquilin 5 OS=Mus musculus OX=10090 GN=Ubqln5 PE=1 SV=1
17	Q9NIF3	7.54e-42	160	523	0.244	0.291	UBQL_DICDI Ubiquilin OS=Dictyostelium discoideum OX=44689 GN=ubqln PE=1 SV=1
18	P48510	2.89e-17	86.3	373	0.119	0.198	DSK2_YEAST Ubiquitin domain-containing protein DSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSK2 PE=1 SV=2
19	Q10169	2.46e-12	70.9	354	0.104	0.184	DSK2_SCHPO Deubiquitination-protection protein dph1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dph1 PE=4 SV=1
20	O42967	5.40e-06	52.0	603	0.066	0.068	YB92_SCHPO Uncharacterized ubiquitin-like protein C1E8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1E8.02 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02991 ATG8	1.8e+02	13.7	Autophagy protein Atg8 ubiquitin like
2	PF02845 CUE	2.4e+02	12.9	CUE domain
3	PF10302 Dsc3_N	59	15.7	DSC E3 ubiquitin ligase complex subunit 3, ubiquitin-like domain
4	PF16678 HOIP-UBA	4.9e+02	12.0	HOIP UBA domain pair
5	PF11976 Rad60-SLD	0.0061	27.7	Ubiquitin-2 like Rad60 SUMO-like
6	PF13881 Rad60-SLD_2	7.3	18.1	Ubiquitin-2 like Rad60 SUMO-like
7	PF17830 STI1	1.7e-08	45.6	STI1 domain
8	PF00627 UBA	0.00094	30.3	UBA/TS-N domain
9	PF00240 ubiquitin	1.8e-14	64.6	Ubiquitin family
10	PF18036 Ubiquitin_4	2e+02	13.4	Ubiquitin-like domain
11	PF18037 Ubiquitin_5	17	17.2	Ubiquitin-like domain
12	PF08817 YukD	2.5	20.2	WXG100 protein secretion system (Wss), protein YukD

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345195

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357879	0.999	26S proteasome non-ATPase regulatory subunit 4
2	9606.ENSP00000467024	0.991	UV excision repair protein RAD23 homolog A
3	9606.ENSP00000478877	0.978	Proteasomal ubiquitin receptor ADRM1
4	9606.ENSP00000302961	0.975	Heat shock protein family A member 4
5	9606.ENSP00000479606	0.946	Clathrin heavy chain 1
6	9606.ENSP00000347244	0.922	Intersectin-2
7	9606.ENSP00000370719	0.922	Intersectin-1
8	9606.ENSP00000351777	0.915	Transitional endoplasmic reticulum ATPase
9	9606.ENSP00000292807	0.912	AP-2 complex subunit mu
10	9606.ENSP00000386456	0.912	AP2-associated protein kinase 1
11	9606.ENSP00000434034	0.907	Frizzled-4
12	9606.ENSP00000482835	0.907	AP-2 complex subunit beta
13	9606.ENSP00000327694	0.906	AP-2 complex subunit alpha-2
14	9606.ENSP00000351926	0.906	AP-2 complex subunit alpha-1
15	9606.ENSP00000392065	0.906	RalBP1-associated Eps domain-containing protein 1
16	9606.ENSP00000441158	0.906	Clathrin heavy chain 2
17	9606.ENSP00000457703	0.905	Ubiquitin-like protein 7
18	9606.ENSP00000242285	0.904	Clathrin light chain A
19	9606.ENSP00000360076	0.904	SH3-containing GRB2-like protein 3-interacting protein 1
20	9606.ENSP00000393776	0.904	F-BAR domain only protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0042802	0.506	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0071704	0.986	organic substance metabolic process
GO:0044238	0.985	primary metabolic process
GO:0044237	0.984	cellular metabolic process
GO:0080134	0.983	regulation of response to stress
GO:0006807	0.962	nitrogen compound metabolic process
GO:0048523	0.959	negative regulation of cellular process
GO:1903050	0.939	regulation of proteolysis involved in protein catabolic process
GO:0043170	0.936	macromolecule metabolic process
GO:0061136	0.933	regulation of proteasomal protein catabolic process
GO:0019538	0.926	protein metabolic process
GO:2000058	0.920	regulation of ubiquitin-dependent protein catabolic process
GO:0032434	0.914	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0050896	0.913	response to stimulus
GO:0006508	0.910	proteolysis
GO:0044260	0.908	cellular macromolecule metabolic process
GO:0048518	0.905	positive regulation of biological process
GO:0051716	0.893	cellular response to stimulus
GO:0048522	0.881	positive regulation of cellular process
GO:0006950	0.878	response to stress
GO:0080135	0.875	regulation of cellular response to stress
GO:0006511	0.875	ubiquitin-dependent protein catabolic process
GO:0051051	0.857	negative regulation of transport
GO:0023051	0.845	regulation of signaling
GO:0010498	0.843	proteasomal protein catabolic process
GO:0009893	0.841	positive regulation of metabolic process
GO:0009966	0.836	regulation of signal transduction
GO:0010604	0.832	positive regulation of macromolecule metabolic process
GO:0042221	0.826	response to chemical
GO:0051173	0.826	positive regulation of nitrogen compound metabolic process
GO:0033554	0.786	cellular response to stress
GO:0043161	0.765	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0051247	0.760	positive regulation of protein metabolic process
GO:1905897	0.758	regulation of response to endoplasmic reticulum stress
GO:0036503	0.758	ERAD pathway
GO:0030433	0.743	ubiquitin-dependent ERAD pathway
GO:1901800	0.734	positive regulation of proteasomal protein catabolic process
GO:0016241	0.727	regulation of macroautophagy
GO:0031325	0.714	positive regulation of cellular metabolic process
GO:2000060	0.696	positive regulation of ubiquitin-dependent protein catabolic process
GO:0048584	0.687	positive regulation of response to stimulus
GO:0051128	0.666	regulation of cellular component organization
GO:0033043	0.627	regulation of organelle organization
GO:1905898	0.623	positive regulation of response to endoplasmic reticulum stress
GO:0032436	0.584	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0051129	0.536	negative regulation of cellular component organization
GO:0071840	0.444	cellular component organization or biogenesis
GO:0016043	0.398	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005886	0.987	plasma membrane
GO:0043231	0.971	intracellular membrane-bounded organelle
GO:0031981	0.940	nuclear lumen
GO:0032991	0.936	protein-containing complex
GO:0005654	0.785	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]