StarFunc result for job id Q9UHE5

User Input

>input (227 residues)
MAPCHIRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVSGSW
LLALVFSISLFPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVG
MVGALPVDDPTLREKRLQLFHLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTI
QLSAMALYQSMGFKKTGQSFFCVWARLVALHTVHFIYHLPSSKVGSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UHE5	1.000	1.000	6.710E-46	227	1.000	1.000	Q9UHE5.pdb.gz	NAT8_HUMAN N-acetyltransferase 8 OS=Homo sapiens OX=9606 GN=NAT8 PE=1 SV=2
2	AFDB:Q9UHF3	0.976	0.976	3.468E-41	227	0.872	0.872	Q9UHF3.pdb.gz	NAT8B_HUMAN Putative N-acetyltransferase 8B OS=Homo sapiens OX=9606 GN=NAT8B PE=5 SV=1
3	AFDB:E0CYR6	0.956	0.956	4.875E-34	227	0.573	0.573	E0CYR6.pdb.gz	NT8F7_MOUSE N-acetyltransferase family 8 member 7 OS=Mus musculus OX=10090 GN=Nat8f7 PE=1 SV=1
4	AFDB:Q9JIY7	0.953	0.953	6.332E-33	227	0.612	0.612	Q9JIY7.pdb.gz	NAT8_MOUSE N-acetyltransferase 8 OS=Mus musculus OX=10090 GN=Nat8 PE=1 SV=1
5	AFDB:Q9JIZ0	0.952	0.973	9.613E-33	222	0.564	0.577	Q9JIZ0.pdb.gz	CMLO1_MOUSE Probable N-acetyltransferase CML1 OS=Mus musculus OX=10090 GN=Cml1 PE=1 SV=1
6	AFDB:Q9QXS8	0.943	0.943	5.346E-30	227	0.546	0.546	Q9QXS8.pdb.gz	CMLO5_MOUSE Probable N-acetyltransferase CML5 OS=Mus musculus OX=10090 GN=Cml5 PE=2 SV=2
7	AFDB:Q9I8W5	0.911	0.943	4.045E-24	219	0.326	0.338	Q9I8W5.pdb.gz	CMLO_XENLA Probable N-acetyltransferase camello OS=Xenopus laevis OX=8355 GN=cml PE=2 SV=1
8	AFDB:E7EZI9	0.910	0.934	8.663E-22	221	0.335	0.344	E7EZI9.pdb.gz
9	AFDB:Q8N9F0	0.813	0.627	1.179E-18	302	0.308	0.232	Q8N9F0.pdb.gz	NAT8L_HUMAN N-acetylaspartate synthetase OS=Homo sapiens OX=9606 GN=NAT8L PE=1 SV=3
10	AFDB:Q10436	0.708	0.687	4.107E-13	235	0.145	0.140	Q10436.pdb.gz	YDE2_SCHPO Uncharacterized protein C12B10.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC12B10.02c PE=4 SV=1
11	PDB:1tiqA	0.599	0.763	2.614E-9	173	0.137	0.179	1tiqA.pdb.gz	Structural and functional evidence for Bacillus subtilis PaiA as a novel N1-spermidine/spermine acetyltransferase.
12	PDB:5c88A	0.516	0.731	8.615E-9	158	0.150	0.215	5c88A.pdb.gz	Multiple Conformations of the Loop Region Confers Heat-Resistance on SsArd1, a Thermophilic NatA.
13	PDB:3dr8A	0.526	0.677	1.094E-8	173	0.137	0.179	3dr8A.pdb.gz	Structure of yncA, a putative ACETYLTRANSFERASE from Salmonella typhimurium with its cofactor Acetyl-CoA
14	PDB:6ygbA	0.440	0.617	1.388E-8	159	0.115	0.164	6ygbA.pdb.gz	Divergent architecture of the heterotrimeric NatC complex explains N-terminal acetylation of cognate substrates.
15	PDB:5isvA	0.460	0.649	3.396E-8	156	0.110	0.160	5isvA.pdb.gz
16	PDB:7l1kA	0.443	0.662	6.164E-8	149	0.110	0.168	7l1kA.pdb.gz	Molecular mechanism of N-terminal acetylation by the ternary NatC complex.
17	PDB:5jq4B	0.379	0.566	6.945E-8	146	0.110	0.171	5jq4B.pdb.gz
18	PDB:6e1xC	0.506	0.629	8.306E-8	176	0.132	0.170	6e1xC.pdb.gz	Crystal structure of product-bound complex of spermidine/spermine N-acetyltransferase SpeG from Vibrio cholerae.
19	PDB:6c95B	0.446	0.619	1.054E-7	161	0.110	0.155	6c95B.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
20	PDB:2ob0C	0.453	0.607	1.338E-7	166	0.101	0.139	2ob0C.pdb.gz	Structure of Human MAK3 homolog

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UHE5	3.16e-168	464	227	1.000	1.000	NAT8_HUMAN N-acetyltransferase 8 OS=Homo sapiens OX=9606 GN=NAT8 PE=1 SV=2
2	Q9UHF3	7.06e-133	374	227	0.872	0.872	NAT8B_HUMAN Putative N-acetyltransferase 8B OS=Homo sapiens OX=9606 GN=NAT8B PE=5 SV=1
3	Q9JIY7	2.31e-73	224	227	0.608	0.608	NAT8_MOUSE N-acetyltransferase 8 OS=Mus musculus OX=10090 GN=Nat8 PE=1 SV=1
4	Q9JIZ0	5.16e-70	215	222	0.564	0.577	CMLO1_MOUSE Probable N-acetyltransferase CML1 OS=Mus musculus OX=10090 GN=Cml1 PE=1 SV=1
5	Q9QXS8	4.10e-67	208	227	0.555	0.555	CMLO5_MOUSE Probable N-acetyltransferase CML5 OS=Mus musculus OX=10090 GN=Cml5 PE=2 SV=2
6	Q9JIY8	6.67e-66	205	226	0.577	0.580	NT8F3_MOUSE N-acetyltransferase family 8 member 3 OS=Mus musculus OX=10090 GN=Nat8f3 PE=1 SV=1
7	E0CYR6	1.02e-65	204	227	0.573	0.573	NT8F7_MOUSE N-acetyltransferase family 8 member 7 OS=Mus musculus OX=10090 GN=Nat8f7 PE=1 SV=1
8	Q9I8W5	4.06e-37	131	219	0.317	0.329	CMLO_XENLA Probable N-acetyltransferase camello OS=Xenopus laevis OX=8355 GN=cml PE=2 SV=1
9	Q8N9F0	5.00e-29	112	302	0.300	0.225	NAT8L_HUMAN N-acetylaspartate synthetase OS=Homo sapiens OX=9606 GN=NAT8L PE=1 SV=3
10	D3ZVU9	6.40e-29	112	299	0.300	0.227	NAT8L_RAT N-acetylaspartate synthetase OS=Rattus norvegicus OX=10116 GN=Nat8l PE=1 SV=1
11	Q3UGX3	4.79e-28	109	299	0.295	0.224	NAT8L_MOUSE N-acetylaspartate synthetase OS=Mus musculus OX=10090 GN=Nat8l PE=1 SV=1
12	O94340	1.64e-05	45.8	163	0.128	0.178	YHM7_SCHPO Uncharacterized N-acetyltransferase C1271.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1271.07c PE=3 SV=1
13	Q147X3	2.05e-05	47.0	362	0.132	0.083	NAA30_HUMAN N-alpha-acetyltransferase 30 OS=Homo sapiens OX=9606 GN=NAA30 PE=1 SV=1
14	P0A944	3.12e-04	42.0	148	0.132	0.203	RIMI_ECOLI [Ribosomal protein bS18]-alanine N-acetyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rimI PE=1 SV=1
15	Q54441	0.001	40.4	146	0.088	0.137	AAC6C_SERMA Aminoglycoside N(6')-acetyltransferase type 1 OS=Serratia marcescens OX=615 PE=1 SV=1
16	O74311	0.002	39.7	150	0.088	0.133	NAA30_SCHPO N-alpha-acetyltransferase 30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=naa30 PE=1 SV=1
17	Q5HH30	0.002	39.3	144	0.093	0.146	ATSE_STAAC Acetyltransferase SACOL1063 OS=Staphylococcus aureus (strain COL) OX=93062 GN=SACOL1063 PE=1 SV=1
18	O16486	0.004	39.7	278	0.093	0.076	O16486_CAEEL N-acetyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=natc-2 PE=1 SV=1
19	I6YG32	0.005	38.5	158	0.093	0.133	RIMI_MYCTU N-alpha-acetyltransferase RimI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rimI PE=1 SV=1
20	P09163	0.005	38.5	147	0.141	0.218	YJAB_ECOLI Peptidyl-lysine N-acetyltransferase YjaB OS=Escherichia coli (strain K12) OX=83333 GN=yjaB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00583 Acetyltransf_1	2.2e-15	68.3	Acetyltransferase (GNAT) family
2	PF13673 Acetyltransf_10	2.1e-11	55.3	Acetyltransferase (GNAT) domain
3	PF13880 Acetyltransf_13	36	15.6	ESCO1/2 acetyl-transferase
4	PF17013 Acetyltransf_15	67	14.4	Putative acetyl-transferase
5	PF13302 Acetyltransf_3	0.024	26.7	Acetyltransferase (GNAT) domain
6	PF13420 Acetyltransf_4	0.0011	30.5	Acetyltransferase (GNAT) domain
7	PF13508 Acetyltransf_7	3.8e-12	57.7	Acetyltransferase (GNAT) domain
8	PF13523 Acetyltransf_8	95	14.1	Acetyltransferase (GNAT) domain
9	PF13527 Acetyltransf_9	0.00034	32.2	Acetyltransferase (GNAT) domain
10	PF14542 Acetyltransf_CG	0.00027	32.2	GCN5-related N-acetyl-transferase
11	PF08445 FR47	0.068	24.5	FR47-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000272425

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300060	0.936	Aminopeptidase N
2	9606.ENSP00000318585	0.925	Beta-secretase 1
3	9606.ENSP00000226299	0.900	Cytosol aminopeptidase
4	9606.ENSP00000354972	0.833	N-alpha-acetyltransferase 35, NatC auxiliary subunit
5	9606.ENSP00000225916	0.799	Histone acetyltransferase KAT2A
6	9606.ENSP00000263754	0.773	Histone acetyltransferase KAT2B
7	9606.ENSP00000261745	0.622	N-alpha-acetyltransferase 25, NatB auxiliary subunit
8	9606.ENSP00000359607	0.612	Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2
9	9606.ENSP00000255226	0.596	Urea transporter 2
10	9606.ENSP00000264436	0.582	Beta-adducin
11	9606.ENSP00000335636	0.578	N-alpha-acetyltransferase 20
12	9606.ENSP00000368716	0.573	N-alpha-acetyltransferase 16, NatA auxiliary subunit
13	9606.ENSP00000296543	0.551	N-alpha-acetyltransferase 15, NatA auxiliary subunit
14	9606.ENSP00000368305	0.532	Glycerophosphocholine phosphodiesterase GPCPD1
15	9606.ENSP00000419970	0.520	NADPH--cytochrome P450 reductase
16	9606.ENSP00000482968	0.517	Alstrom syndrome protein 1
17	9606.ENSP00000361140	0.503	Alcohol dehydrogenase [NADP(+)]
18	9606.ENSP00000428612	0.503	Sodium/bile acid cotransporter 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008080	1.000	N-acetyltransferase activity
GO:0034212	0.706	peptide N-acetyltransferase activity
GO:0004468	0.493	lysine N-acetyltransferase activity, acting on acetyl phosphate as donor

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0009987	0.988	cellular process
GO:0043543	0.985	protein acylation
GO:0065007	0.976	biological regulation
GO:0019222	0.973	regulation of metabolic process
GO:0006473	0.972	protein acetylation
GO:0018193	0.954	peptidyl-amino acid modification
GO:0071840	0.946	cellular component organization or biogenesis
GO:0018205	0.939	peptidyl-lysine modification
GO:0016043	0.937	cellular component organization
GO:0006475	0.874	internal protein amino acid acetylation
GO:0018393	0.826	internal peptidyl-lysine acetylation
GO:0060255	0.808	regulation of macromolecule metabolic process
GO:0048518	0.743	positive regulation of biological process
GO:0010468	0.697	regulation of gene expression
GO:0097435	0.689	supramolecular fiber organization
GO:0009893	0.618	positive regulation of metabolic process
GO:0010604	0.535	positive regulation of macromolecule metabolic process
GO:0050794	0.370	regulation of cellular process
GO:0010628	0.302	positive regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0031090	1.000	organelle membrane
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.997	endomembrane system
GO:0005793	0.966	endoplasmic reticulum-Golgi intermediate compartment
GO:0031984	0.945	organelle subcompartment
GO:0098588	0.943	bounding membrane of organelle
GO:0042175	0.941	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0033116	0.932	endoplasmic reticulum-Golgi intermediate compartment membrane
GO:0005789	0.930	endoplasmic reticulum membrane
GO:0005829	0.411	cytosol
GO:0005634	0.359	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
RHEA:14417	0.493	acetyl phosphate + L-lysine = H(+) + N(6)-acetyl-L-lysine + phosphate
EC:2.3.1.32	0.493	lysine N-acetyltransferase.

[back to server]