StarFunc result for job id Q9UHF1

User Input

>input (273 residues)
MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHR
ACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQP
GRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKG
GPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLL
VHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UHF1	1.000	1.000	5.667E-48	273	1.000	1.000	Q9UHF1.pdb.gz	EGFL7_HUMAN Epidermal growth factor-like protein 7 OS=Homo sapiens OX=9606 GN=EGFL7 PE=1 SV=3
2	AFDB:Q9QXT5	0.419	0.418	9.172E-33	275	0.784	0.778	Q9QXT5.pdb.gz	EGFL7_MOUSE Epidermal growth factor-like protein 7 OS=Mus musculus OX=10090 GN=Egfl7 PE=2 SV=2
3	AFDB:Q08CR0	0.425	0.418	2.885E-18	277	0.421	0.415	Q08CR0.pdb.gz
4	AFDB:Q99944	0.368	0.348	7.218E-17	293	0.355	0.331	Q99944.pdb.gz	EGFL8_HUMAN Epidermal growth factor-like protein 8 OS=Homo sapiens OX=9606 GN=EGFL8 PE=1 SV=1
5	AFDB:Q95RQ1	0.385	0.217	6.709E-14	512	0.242	0.129	Q95RQ1.pdb.gz	Q95RQ1_DROME LD16414p OS=Drosophila melanogaster OX=7227 GN=slow PE=2 SV=1
6	AFDB:O75095	0.245	0.046	3.969E-11	1541	0.198	0.035	O75095.pdb.gz	MEGF6_HUMAN Multiple epidermal growth factor-like domains protein 6 OS=Homo sapiens OX=9606 GN=MEGF6 PE=1 SV=4
7	AFDB:Q80V70	0.247	0.057	5.109E-9	1572	0.209	0.036	Q80V70.pdb.gz	MEGF6_MOUSE Multiple epidermal growth factor-like domains protein 6 OS=Mus musculus OX=10090 GN=Megf6 PE=2 SV=3
8	AFDB:M9PBB4	0.276	0.145	1.695E-7	622	0.168	0.074	M9PBB4.pdb.gz	M9PBB4_DROME Nimrod C1, isoform B OS=Drosophila melanogaster OX=7227 GN=NimC1 PE=4 SV=1
9	AFDB:Q8MS81	0.310	0.189	4.428E-7	507	0.161	0.087	Q8MS81.pdb.gz	Q8MS81_DROME LP05465p OS=Drosophila melanogaster OX=7227 GN=NimC1 PE=2 SV=1
10	AFDB:Q91V88	0.301	0.151	2.035E-6	561	0.150	0.073	Q91V88.pdb.gz	NPNT_MOUSE Nephronectin OS=Mus musculus OX=10090 GN=Npnt PE=1 SV=1
11	PDB:7q3nU	0.198	0.187	1.055E-1	292	0.099	0.092	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
12	PDB:4bxsA	0.142	0.156	1.658E-1	248	0.051	0.056	4bxsA.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
13	PDB:7abzS	0.095	0.211	3.657E-1	110	0.037	0.091	7abzS.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
14	PDB:3m3rC	0.087	0.083	8.532E-1	293	0.033	0.031	3m3rC.pdb.gz
15	PDB:2ymwB	0.100	0.053	1.070	685	0.037	0.015	2ymwB.pdb.gz
16	PDB:5jzwH	0.103	0.078	1.419	401	0.022	0.015	5jzwH.pdb.gz
17	PDB:4bxwB	0.116	0.111	1.991	287	0.048	0.045	4bxwB.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
18	PDB:5apnP	0.100	0.142	2.229	183	0.040	0.060	5apnP.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
19	PDB:6sb3A	0.119	0.060	2.358	604	0.015	0.007	6sb3A.pdb.gz
20	PDB:3b07B	0.113	0.114	2.495	270	0.011	0.011	3b07B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UHF1	0.0	553	273	1.000	1.000	EGFL7_HUMAN Epidermal growth factor-like protein 7 OS=Homo sapiens OX=9606 GN=EGFL7 PE=1 SV=3
2	Q9QXT5	1.56e-154	433	275	0.784	0.778	EGFL7_MOUSE Epidermal growth factor-like protein 7 OS=Mus musculus OX=10090 GN=Egfl7 PE=2 SV=2
3	Q1RLZ3	8.29e-67	211	277	0.418	0.412	Q1RLZ3_DANRE EGF-like-domain, multiple 7 OS=Danio rerio OX=7955 GN=zgc:136669 PE=2 SV=1
4	Q99944	1.33e-40	144	293	0.348	0.324	EGFL8_HUMAN Epidermal growth factor-like protein 8 OS=Homo sapiens OX=9606 GN=EGFL8 PE=1 SV=1
5	Q95RQ1	1.56e-22	98.6	512	0.242	0.129	Q95RQ1_DROME LD16414p OS=Drosophila melanogaster OX=7227 GN=slow PE=2 SV=1
6	Q8IUX8	2.25e-18	86.7	553	0.176	0.087	EGFL6_HUMAN Epidermal growth factor-like protein 6 OS=Homo sapiens OX=9606 GN=EGFL6 PE=1 SV=1
7	Q9JJZ5	8.31e-18	85.1	550	0.172	0.085	EGFL6_MOUSE Epidermal growth factor-like protein 6 OS=Mus musculus OX=10090 GN=Egfl6 PE=1 SV=1
8	Q91V88	4.38e-14	73.9	561	0.158	0.077	NPNT_MOUSE Nephronectin OS=Mus musculus OX=10090 GN=Npnt PE=1 SV=1
9	Q6UXI9	9.18e-14	73.2	565	0.154	0.074	NPNT_HUMAN Nephronectin OS=Homo sapiens OX=9606 GN=NPNT PE=2 SV=3
10	Q6DHG1	2.31e-13	71.6	508	0.139	0.075	Q6DHG1_DANRE EGF-like-domain, multiple 6 OS=Danio rerio OX=7955 GN=sb:cb3 PE=2 SV=1
11	Q80V70	6.44e-13	70.9	1572	0.194	0.034	MEGF6_MOUSE Multiple epidermal growth factor-like domains protein 6 OS=Mus musculus OX=10090 GN=Megf6 PE=2 SV=3
12	O75095	6.92e-13	70.9	1541	0.179	0.032	MEGF6_HUMAN Multiple epidermal growth factor-like domains protein 6 OS=Homo sapiens OX=9606 GN=MEGF6 PE=1 SV=4
13	Q8BNA6	2.52e-11	66.2	4555	0.154	0.009	FAT3_MOUSE Protocadherin Fat 3 OS=Mus musculus OX=10090 GN=Fat3 PE=1 SV=2
14	Q7T3H4	4.56e-11	65.1	648	0.187	0.079	Q7T3H4_DANRE Growth arrest-specific 6 OS=Danio rerio OX=7955 GN=fj34a12 PE=2 SV=1
15	B8A5G4	7.72e-11	64.3	605	0.154	0.069	B8A5G4_DANRE Nephronectin a OS=Danio rerio OX=7955 GN=POEM PE=3 SV=1
16	Q14393	8.06e-11	64.3	678	0.183	0.074	GAS6_HUMAN Growth arrest-specific protein 6 OS=Homo sapiens OX=9606 GN=GAS6 PE=1 SV=3
17	Q14517	1.11e-10	64.3	4588	0.099	0.006	FAT1_HUMAN Protocadherin Fat 1 OS=Homo sapiens OX=9606 GN=FAT1 PE=1 SV=2
18	A0A087WRT4	1.47e-10	63.9	4602	0.106	0.006	A0A087WRT4_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=2
19	A0A1L1SQU7	1.47e-10	63.9	4645	0.106	0.006	A0A1L1SQU7_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
20	F2Z4A3	1.47e-10	63.9	4590	0.106	0.006	F2Z4A3_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	3.1	19.1	Complement Clr-like EGF-like
2	PF00008 EGF	2.9	19.6	EGF-like domain
3	PF07974 EGF_2	0.19	23.4	EGF-like domain
4	PF07645 EGF_CA	0.00053	31.5	Calcium-binding EGF domain
5	PF07546 EMI	4.3e-15	67.5	EMI domain
6	PF14670 FXa_inhibition	0.001	30.6	Coagulation Factor Xa inhibitory site
7	PF12661 hEGF	16	17.5	Human growth factor-like EGF
8	PF08954 Trimer_CC	8.2e+02	11.0	Trimerisation motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360764

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000299084	0.795	Sprouty-related, EVH1 domain-containing protein 1
2	9606.ENSP00000222254	0.789	Phosphatidylinositol 3-kinase regulatory subunit beta
3	9606.ENSP00000265171	0.780	Pro-epidermal growth factor
4	9606.ENSP00000256646	0.682	Neurogenic locus notch homolog protein 2
5	9606.ENSP00000249749	0.657	Delta-like protein 4
6	9606.ENSP00000263388	0.653	Neurogenic locus notch homolog protein 3
7	9606.ENSP00000364163	0.644	Neurogenic locus notch homolog protein 4
8	9606.ENSP00000277541	0.600	Neurogenic locus notch homolog protein 1
9	9606.ENSP00000478570	0.559	Vascular endothelial growth factor A
10	9606.ENSP00000228837	0.555	Fibroblast growth factor 6
11	9606.ENSP00000290079	0.546	Transmembrane protein 141
12	9606.ENSP00000385477	0.522	Claudin-5
13	9606.ENSP00000328169	0.517	Protein jagged-2
14	9606.ENSP00000381498	0.508	Fibroblast growth factor receptor-like 1
15	9606.ENSP00000418491	0.508	Epididymal-specific lipocalin-10
16	9606.ENSP00000436262	0.508	Kelch repeat and BTB domain containing 3
17	9606.ENSP00000300574	0.504	Adapter molecule crk
18	9606.ENSP00000278927	0.502	Endothelial cell-selective adhesion molecule

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.514	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048519	0.975	negative regulation of biological process
GO:0009987	0.968	cellular process
GO:0048523	0.965	negative regulation of cellular process
GO:0048518	0.879	positive regulation of biological process
GO:0009966	0.878	regulation of signal transduction
GO:0050678	0.854	regulation of epithelial cell proliferation
GO:0048522	0.838	positive regulation of cellular process
GO:0048856	0.827	anatomical structure development
GO:0048585	0.806	negative regulation of response to stimulus
GO:0032501	0.783	multicellular organismal process
GO:0001936	0.736	regulation of endothelial cell proliferation
GO:0048731	0.720	system development
GO:0023057	0.695	negative regulation of signaling
GO:0008593	0.682	regulation of Notch signaling pathway
GO:0009968	0.681	negative regulation of signal transduction
GO:0050896	0.622	response to stimulus
GO:0008284	0.621	positive regulation of cell population proliferation
GO:0009653	0.612	anatomical structure morphogenesis
GO:0019222	0.486	regulation of metabolic process
GO:0072359	0.447	circulatory system development
GO:0048869	0.441	cellular developmental process
GO:0030154	0.434	cell differentiation
GO:2000145	0.432	regulation of cell motility
GO:0051716	0.412	cellular response to stimulus
GO:0030334	0.400	regulation of cell migration
GO:0045746	0.387	negative regulation of Notch signaling pathway
GO:0048514	0.379	blood vessel morphogenesis
GO:0007165	0.376	signal transduction
GO:0060255	0.346	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0062023	0.966	collagen-containing extracellular matrix
GO:0005576	0.962	extracellular region
GO:0043226	0.811	organelle
GO:0005622	0.808	intracellular anatomical structure
GO:0005886	0.779	plasma membrane
GO:0043227	0.765	membrane-bounded organelle
GO:0043229	0.705	intracellular organelle
GO:0005737	0.690	cytoplasm
GO:0005615	0.646	extracellular space
GO:0043231	0.613	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]