StarFunc result for job id Q9UHF3

User Input

>input (227 residues)
MAPYHIRKYQESDRKSVVGLLSGGMAEHAPATFRRLLKLPRTLILLLGGALALLLVSGSW
ILALVFSLSLLPALWFLAKKPWTRYVDIALRTDMSDITKSYLSECGSCFWVAESEEKVVG
TVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKALVRTVLQFARDQGYSEVVLDTSNI
QLSAMGLYQSLGFKKTGQSFFHVWARLVDLHTVHFIYHLPSAQAGRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UHF3	1.000	1.000	7.243E-47	227	1.000	1.000	Q9UHF3.pdb.gz	NAT8B_HUMAN Putative N-acetyltransferase 8B OS=Homo sapiens OX=9606 GN=NAT8B PE=5 SV=1
2	AFDB:Q9UHE5	0.976	0.976	1.524E-41	227	0.872	0.872	Q9UHE5.pdb.gz	NAT8_HUMAN N-acetyltransferase 8 OS=Homo sapiens OX=9606 GN=NAT8 PE=1 SV=2
3	AFDB:E0CYR6	0.966	0.966	1.559E-34	227	0.564	0.564	E0CYR6.pdb.gz	NT8F7_MOUSE N-acetyltransferase family 8 member 7 OS=Mus musculus OX=10090 GN=Nat8f7 PE=1 SV=1
4	AFDB:Q9JIY7	0.970	0.970	1.385E-33	227	0.617	0.617	Q9JIY7.pdb.gz	NAT8_MOUSE N-acetyltransferase 8 OS=Mus musculus OX=10090 GN=Nat8 PE=1 SV=1
5	AFDB:Q9JIZ0	0.952	0.973	3.239E-33	222	0.586	0.599	Q9JIZ0.pdb.gz	CMLO1_MOUSE Probable N-acetyltransferase CML1 OS=Mus musculus OX=10090 GN=Cml1 PE=1 SV=1
6	AFDB:Q9QXS8	0.947	0.947	3.680E-31	227	0.564	0.564	Q9QXS8.pdb.gz	CMLO5_MOUSE Probable N-acetyltransferase CML5 OS=Mus musculus OX=10090 GN=Cml5 PE=2 SV=2
7	AFDB:Q9I8W5	0.922	0.955	1.509E-25	219	0.344	0.356	Q9I8W5.pdb.gz	CMLO_XENLA Probable N-acetyltransferase camello OS=Xenopus laevis OX=8355 GN=cml PE=2 SV=1
8	AFDB:E7EZI9	0.915	0.940	1.266E-23	221	0.348	0.357	E7EZI9.pdb.gz
9	AFDB:Q8N9F0	0.821	0.631	1.846E-19	302	0.330	0.248	Q8N9F0.pdb.gz	NAT8L_HUMAN N-acetylaspartate synthetase OS=Homo sapiens OX=9606 GN=NAT8L PE=1 SV=3
10	AFDB:Q10436	0.720	0.699	3.248E-13	235	0.150	0.145	Q10436.pdb.gz	YDE2_SCHPO Uncharacterized protein C12B10.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC12B10.02c PE=4 SV=1
11	PDB:1tiqA	0.606	0.775	9.248E-10	173	0.141	0.185	1tiqA.pdb.gz	Structural and functional evidence for Bacillus subtilis PaiA as a novel N1-spermidine/spermine acetyltransferase.
12	PDB:5jq4B	0.383	0.568	7.278E-9	146	0.119	0.185	5jq4B.pdb.gz
13	PDB:5c88A	0.511	0.724	8.731E-9	158	0.145	0.209	5c88A.pdb.gz	Multiple Conformations of the Loop Region Confers Heat-Resistance on SsArd1, a Thermophilic NatA.
14	PDB:6ygbA	0.437	0.613	8.731E-9	159	0.110	0.157	6ygbA.pdb.gz	Divergent architecture of the heterotrimeric NatC complex explains N-terminal acetylation of cognate substrates.
15	PDB:3dr8A	0.516	0.664	2.042E-8	173	0.137	0.179	3dr8A.pdb.gz	Structure of yncA, a putative ACETYLTRANSFERASE from Salmonella typhimurium with its cofactor Acetyl-CoA
16	PDB:5isvA	0.429	0.604	2.603E-8	156	0.106	0.154	5isvA.pdb.gz
17	PDB:7l1kA	0.440	0.657	3.122E-8	149	0.128	0.195	7l1kA.pdb.gz	Molecular mechanism of N-terminal acetylation by the ternary NatC complex.
18	PDB:6e1xC	0.493	0.614	8.243E-8	176	0.132	0.170	6e1xC.pdb.gz	Crystal structure of product-bound complex of spermidine/spermine N-acetyltransferase SpeG from Vibrio cholerae.
19	PDB:4hnxB	0.487	0.516	1.051E-7	213	0.163	0.174	4hnxB.pdb.gz	The Protein Complex NatA Binds Inositol Hexakisphosphate and Exhibits Conformational Flexibility
20	PDB:2ob0C	0.445	0.590	1.116E-7	166	0.119	0.163	2ob0C.pdb.gz	Structure of Human MAK3 homolog

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UHF3	1.54e-167	462	227	1.000	1.000	NAT8B_HUMAN Putative N-acetyltransferase 8B OS=Homo sapiens OX=9606 GN=NAT8B PE=5 SV=1
2	Q9UHE5	2.07e-133	376	227	0.872	0.872	NAT8_HUMAN N-acetyltransferase 8 OS=Homo sapiens OX=9606 GN=NAT8 PE=1 SV=2
3	Q9JIY7	3.62e-76	231	227	0.612	0.612	NAT8_MOUSE N-acetyltransferase 8 OS=Mus musculus OX=10090 GN=Nat8 PE=1 SV=1
4	Q9JIZ0	9.99e-74	224	222	0.586	0.599	CMLO1_MOUSE Probable N-acetyltransferase CML1 OS=Mus musculus OX=10090 GN=Cml1 PE=1 SV=1
5	Q9QXS8	4.89e-68	210	227	0.577	0.577	CMLO5_MOUSE Probable N-acetyltransferase CML5 OS=Mus musculus OX=10090 GN=Cml5 PE=2 SV=2
6	E0CYR6	4.29e-65	203	227	0.564	0.564	NT8F7_MOUSE N-acetyltransferase family 8 member 7 OS=Mus musculus OX=10090 GN=Nat8f7 PE=1 SV=1
7	Q9JIY8	5.28e-65	202	226	0.559	0.562	NT8F3_MOUSE N-acetyltransferase family 8 member 3 OS=Mus musculus OX=10090 GN=Nat8f3 PE=1 SV=1
8	Q9I8W5	1.42e-40	140	219	0.335	0.347	CMLO_XENLA Probable N-acetyltransferase camello OS=Xenopus laevis OX=8355 GN=cml PE=2 SV=1
9	Q8N9F0	1.30e-32	121	302	0.326	0.245	NAT8L_HUMAN N-acetylaspartate synthetase OS=Homo sapiens OX=9606 GN=NAT8L PE=1 SV=3
10	D3ZVU9	1.46e-32	121	299	0.326	0.247	NAT8L_RAT N-acetylaspartate synthetase OS=Rattus norvegicus OX=10116 GN=Nat8l PE=1 SV=1
11	Q3UGX3	1.34e-31	119	299	0.322	0.244	NAT8L_MOUSE N-acetylaspartate synthetase OS=Mus musculus OX=10090 GN=Nat8l PE=1 SV=1
12	Q5HH30	4.43e-07	50.1	144	0.154	0.243	ATSE_STAAC Acetyltransferase SACOL1063 OS=Staphylococcus aureus (strain COL) OX=93062 GN=SACOL1063 PE=1 SV=1
13	O94340	6.72e-07	49.7	163	0.154	0.215	YHM7_SCHPO Uncharacterized N-acetyltransferase C1271.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1271.07c PE=3 SV=1
14	O74311	3.15e-05	45.1	150	0.093	0.140	NAA30_SCHPO N-alpha-acetyltransferase 30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=naa30 PE=1 SV=1
15	P09163	1.25e-04	43.1	147	0.154	0.238	YJAB_ECOLI Peptidyl-lysine N-acetyltransferase YjaB OS=Escherichia coli (strain K12) OX=83333 GN=yjaB PE=1 SV=1
16	Q147X3	2.18e-04	43.9	362	0.132	0.083	NAA30_HUMAN N-alpha-acetyltransferase 30 OS=Homo sapiens OX=9606 GN=NAA30 PE=1 SV=1
17	Q18B70	4.56e-04	41.6	159	0.106	0.151	ATSE_CLOD6 Acetyltransferase CD1211 OS=Clostridioides difficile (strain 630) OX=272563 GN=CD630_12110 PE=4 SV=1
18	Q03503	8.95e-04	41.2	176	0.084	0.108	NAA30_YEAST N-alpha-acetyltransferase 30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAK3 PE=1 SV=1
19	Q383G8	0.002	40.0	147	0.084	0.129	Q383G8_TRYB2 Glucosamine 6-phosphate N-acetyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2886 PE=3 SV=1
20	I6YG32	0.003	39.3	158	0.088	0.127	RIMI_MYCTU N-alpha-acetyltransferase RimI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rimI PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00583 Acetyltransf_1	1.5e-15	68.9	Acetyltransferase (GNAT) family
2	PF13673 Acetyltransf_10	1.1e-10	53.0	Acetyltransferase (GNAT) domain
3	PF17013 Acetyltransf_15	4.5e+02	11.7	Putative acetyl-transferase
4	PF13302 Acetyltransf_3	0.044	25.9	Acetyltransferase (GNAT) domain
5	PF13420 Acetyltransf_4	0.0037	28.7	Acetyltransferase (GNAT) domain
6	PF13508 Acetyltransf_7	5.2e-12	57.2	Acetyltransferase (GNAT) domain
7	PF13523 Acetyltransf_8	43	15.2	Acetyltransferase (GNAT) domain
8	PF13527 Acetyltransf_9	0.00065	31.2	Acetyltransferase (GNAT) domain
9	PF14542 Acetyltransf_CG	0.00013	33.3	GCN5-related N-acetyl-transferase
10	PF08445 FR47	0.023	26.0	FR47-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003846254.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008972138.1	0.984	Alanyl aminopeptidase, membrane
2	9597.XP_003809219.2	0.916	N-alpha-acetyltransferase 35, NatC auxiliary subunit isoform X1
3	9597.XP_003846029.1	0.900	Leucine aminopeptidase 3
4	9597.XP_003808251.1	0.801	Probable N-acetyltransferase 8
5	9597.XP_008956335.1	0.715	N-alpha-acetyltransferase 25, NatB auxiliary subunit
6	9597.XP_003806946.1	0.628	N(alpha)-acetyltransferase 16, NatA auxiliary subunit
7	9597.XP_003820718.1	0.628	N-alpha-acetyltransferase 15, NatA auxiliary subunit isoform X1
8	9597.XP_008964728.1	0.572	Belongs to the acetyltransferase family. GCN5 subfamily.
9	9597.XP_003807928.1	0.537	ADP-ribosylation factor-like protein 13B isoform X1
10	9597.XP_003826362.1	0.537	Histone acetyltransferase KAT2B
11	9597.XP_003820119.1	0.535	Belongs to the peptidase A1 family.
12	9597.XP_003809969.1	0.511	ADP ribosylation factor related protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008080	1.000	N-acetyltransferase activity
GO:0034212	0.572	peptide N-acetyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.991	primary metabolic process
GO:1901564	0.986	organonitrogen compound metabolic process
GO:0043412	0.986	macromolecule modification
GO:0009987	0.982	cellular process
GO:0036211	0.982	protein modification process
GO:0043543	0.964	protein acylation
GO:0065007	0.955	biological regulation
GO:0018193	0.943	peptidyl-amino acid modification
GO:0019222	0.942	regulation of metabolic process
GO:0006473	0.930	protein acetylation
GO:0071840	0.890	cellular component organization or biogenesis
GO:0018205	0.886	peptidyl-lysine modification
GO:0006475	0.785	internal protein amino acid acetylation
GO:0018393	0.760	internal peptidyl-lysine acetylation
GO:0016043	0.756	cellular component organization
GO:0060255	0.723	regulation of macromolecule metabolic process
GO:0097435	0.588	supramolecular fiber organization
GO:0050794	0.481	regulation of cellular process
GO:0048518	0.465	positive regulation of biological process
GO:0009893	0.332	positive regulation of metabolic process
GO:0010468	0.330	regulation of gene expression
GO:0010604	0.313	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0031090	0.999	organelle membrane
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0098588	0.965	bounding membrane of organelle
GO:0005783	0.928	endoplasmic reticulum
GO:0031984	0.923	organelle subcompartment
GO:0042175	0.900	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0033116	0.891	endoplasmic reticulum-Golgi intermediate compartment membrane
GO:0005789	0.890	endoplasmic reticulum membrane
GO:0005634	0.382	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.

[back to server]