StarFunc result for job id Q9UHF4

User Input

>input (553 residues)
MRAPGRPALRPLPLPPLLLLLLAAPWGRAVPCVSGGLPKPANITFLSINMKNVLQWTPPE
GLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKC
SKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLK
YNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTL
KDQSSEFKAKIIFWYVLPVSITVFLFSVMGYSIYRYIHVGKEKHPANLILIYGNEFDKRF
FVPAEKIVINFITLNISDDSKISHQDMSLLGKSSDVSSLNDPQPSGNLRPPQEEEEVKHL
GYASHLMEIFCDSEENTEGTSLTQQESLSRTIPPDKTVIEYEYDVRTTDICAGPEEQELS
LQEEVSTQGTLLESQAALAVLGPQTLQYSYTPQLQDLDPLAQEHTDSEEGPEEEPSTTLV
DWDPQTGRLCIPSLSSFDQDSEGCEPSEGDGLGEEGLLSRLYEEPAPDRPPGENETYLMQ
FMEEWGLYVQMEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UHF4	1.000	1.000	8.267E-91	553	1.000	1.000	Q9UHF4.pdb.gz	I20RA_HUMAN Interleukin-20 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL20RA PE=1 SV=2
2	AFDB:Q8N6P7	0.364	0.351	4.079E-25	574	0.208	0.200	Q8N6P7.pdb.gz	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=IL22RA1 PE=1 SV=1
3	AFDB:Q80XF5	0.340	0.786	6.254E-21	230	0.123	0.296	Q80XF5.pdb.gz	I22R2_MOUSE Interleukin-22 receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Il22ra2 PE=1 SV=2
4	AFDB:A0A0S2Z3Y2	0.314	0.350	4.952E-20	489	0.190	0.215	A0A0S2Z3Y2.pdb.gz	A0A0S2Z3Y2_HUMAN Interferon gamma receptor 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=IFNGR1 PE=2 SV=1
5	AFDB:G3V830	0.363	0.353	7.249E-20	569	0.208	0.202	G3V830.pdb.gz	G3V830_RAT Interleukin 10 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il10ra PE=4 SV=1
6	AFDB:D9IL84	0.302	0.292	2.040E-19	573	0.186	0.180	D9IL84.pdb.gz	D9IL84_DANRE Cytokine receptor family member b14 OS=Danio rerio OX=7955 GN=crfb14 PE=2 SV=1
7	AFDB:Q8IU57	0.335	0.354	4.372E-19	520	0.193	0.206	Q8IU57.pdb.gz	INLR1_HUMAN Interferon lambda receptor 1 OS=Homo sapiens OX=9606 GN=IFNLR1 PE=1 SV=1
8	AFDB:Q8CGK5	0.342	0.352	3.655E-18	535	0.163	0.168	Q8CGK5.pdb.gz	INLR1_MOUSE Interferon lambda receptor 1 OS=Mus musculus OX=10090 GN=Ifnlr1 PE=1 SV=1
9	AFDB:P40190	0.169	0.113	2.656E-15	918	0.143	0.086	P40190.pdb.gz	IL6RB_RAT Interleukin-6 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Il6st PE=1 SV=1
10	AFDB:A8WH79	0.172	0.117	3.488E-15	866	0.137	0.088	A8WH79.pdb.gz	A8WH79_DANRE Gp130 protein OS=Danio rerio OX=7955 GN=gp130 PE=2 SV=1
11	PDB:3besR	0.281	0.566	1.745E-10	250	0.072	0.160	3besR.pdb.gz
12	PDB:7u7nC	0.280	0.672	2.055E-10	200	0.065	0.180	7u7nC.pdb.gz
13	PDB:7z0lB	0.269	0.383	4.106E-9	370	0.071	0.105	7z0lB.pdb.gz
14	PDB:6pxvA	0.180	0.130	1.319E-6	823	0.060	0.040	6pxvA.pdb.gz
15	PDB:5mj3A	0.216	0.363	1.470E-6	302	0.042	0.076	5mj3A.pdb.gz
16	PDB:8dtlA	0.165	0.129	3.514E-6	741	0.056	0.042	8dtlA.pdb.gz
17	PDB:8eyyA	0.178	0.136	4.613E-6	775	0.061	0.044	8eyyA.pdb.gz
18	PDB:7bwaA	0.176	0.149	2.782E-5	674	0.052	0.043	7bwaA.pdb.gz
19	PDB:6pyhD	0.164	0.119	3.857E-5	798	0.065	0.045	6pyhD.pdb.gz
20	PDB:6h03A	0.145	0.078	5.647E-5	1223	0.060	0.027	6h03A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PHB0	0.0	667	546	0.613	0.621	I20RA_MOUSE Interleukin-20 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il20ra PE=2 SV=2
2	Q9UHF4	0.0	1142	553	1.000	1.000	I20RA_HUMAN Interleukin-20 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL20RA PE=1 SV=2
3	Q969J5	3.09e-26	110	263	0.134	0.281	I22R2_HUMAN Interleukin-22 receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=IL22RA2 PE=1 SV=1
4	Q80XF5	6.08e-24	102	230	0.118	0.283	I22R2_MOUSE Interleukin-22 receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Il22ra2 PE=1 SV=2
5	Q61190	5.51e-20	93.6	349	0.161	0.255	I10R2_MOUSE Interleukin-10 receptor subunit beta OS=Mus musculus OX=10090 GN=Il10rb PE=1 SV=1
6	Q08334	5.19e-19	90.5	325	0.152	0.258	I10R2_HUMAN Interleukin-10 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL10RB PE=1 SV=2
7	Q8N6P7	4.12e-17	87.0	574	0.110	0.106	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=IL22RA1 PE=1 SV=1
8	Q80XZ4	2.10e-13	75.1	581	0.107	0.102	I22R1_MOUSE Interleukin-22 receptor subunit alpha-1 OS=Mus musculus OX=10090 GN=Il22ra1 PE=1 SV=1
9	V5JFY4	2.69e-12	69.7	268	0.123	0.254	INRA2_ONCMY Interferon alpha/beta receptor 2 OS=Oncorhynchus mykiss OX=8022 GN=ifnar2 PE=2 SV=1
10	K9JA28	3.41e-12	71.2	567	0.081	0.079	INLR1_CHICK Interferon lambda receptor 1 OS=Gallus gallus OX=9031 GN=IFNLR1 PE=2 SV=1
11	P33896	6.34e-12	70.5	590	0.101	0.095	INAR1_MOUSE Interferon alpha/beta receptor 1 OS=Mus musculus OX=10090 GN=Ifnar1 PE=1 SV=2
12	P17181	4.57e-11	67.8	557	0.072	0.072	INAR1_HUMAN Interferon alpha/beta receptor 1 OS=Homo sapiens OX=9606 GN=IFNAR1 PE=1 SV=3
13	K7NA32	3.56e-10	64.3	405	0.112	0.153	IRA1A_ONCMY Interferon alpha/beta receptor 1a OS=Oncorhynchus mykiss OX=8022 GN=ifnar1a PE=2 SV=1
14	A0A2R8Y4U4	6.55e-10	63.9	479	0.074	0.086	A0A2R8Y4U4_HUMAN Interferon gamma receptor 1 OS=Homo sapiens OX=9606 GN=IFNGR1 PE=1 SV=1
15	D3ZDS9	1.74e-09	62.8	593	0.096	0.089	D3ZDS9_RAT Interferon alpha and beta receptor subunit 1 OS=Rattus norvegicus OX=10116 GN=Ifnar1 PE=4 SV=2
16	A0A0S2Z3Y2	3.72e-09	61.6	489	0.072	0.082	A0A0S2Z3Y2_HUMAN Interferon gamma receptor 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=IFNGR1 PE=2 SV=1
17	P15260	3.72e-09	61.6	489	0.072	0.082	INGR1_HUMAN Interferon gamma receptor 1 OS=Homo sapiens OX=9606 GN=IFNGR1 PE=1 SV=1
18	A0A2R8Y7R1	4.19e-09	61.2	470	0.074	0.087	A0A2R8Y7R1_HUMAN Interferon gamma receptor 1 OS=Homo sapiens OX=9606 GN=IFNGR1 PE=1 SV=1
19	A0A8I6AH72	8.34e-09	60.5	582	0.096	0.091	A0A8I6AH72_RAT Interferon alpha and beta receptor subunit 1 OS=Rattus norvegicus OX=10116 GN=Ifnar1 PE=4 SV=1
20	E7F976	1.85e-08	59.3	573	0.092	0.089	E7F976_DANRE Interferon lambda receptor 1 OS=Danio rerio OX=7955 GN=crfb14 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15764 DUF4693	5.3e+02	11.5	Domain of unknown function (DUF4693)
2	PF00041 fn3	0.48	22.1	Fibronectin type III domain
3	PF09294 Interfer-bind	2.4e-21	87.3	Interferon-alpha/beta receptor, fibronectin type III
4	PF01108 Tissue_fac	1.4e-27	107.0	Tissue factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000314976

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343000	0.997	Interleukin-19
2	9606.ENSP00000375795	0.997	Interleukin-24
3	9606.ENSP00000356065	0.993	Interleukin-20
4	9606.ENSP00000328133	0.991	Interleukin-20 receptor subunit beta
5	9606.ENSP00000229134	0.985	Interleukin-26
6	9606.ENSP00000290200	0.869	Interleukin-10 receptor subunit beta
7	9606.ENSP00000343204	0.856	Tyrosine-protein kinase JAK1
8	9606.ENSP00000264657	0.838	Signal transducer and activator of transcription 3
9	9606.ENSP00000412237	0.818	Interleukin-10
10	9606.ENSP00000329991	0.804	Interferon lambda-1
11	9606.ENSP00000354394	0.790	Signal transducer and activator of transcription 1-alpha/beta
12	9606.ENSP00000333639	0.785	Interferon lambda-2
13	9606.ENSP00000409000	0.762	Interferon lambda-3
14	9606.ENSP00000264497	0.724	Interleukin-21
15	9606.ENSP00000431885	0.716	Non-receptor tyrosine-protein kinase TYK2
16	9606.ENSP00000302924	0.715	Interleukin-17D
17	9606.ENSP00000385675	0.714	Interleukin-6
18	9606.ENSP00000369581	0.710	Interferon beta
19	9606.ENSP00000442424	0.697	Interleukin-22
20	9606.ENSP00000373325	0.693	Interleukin-17 receptor E

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004896	0.486	cytokine receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0023052	0.998	signaling
GO:0007154	0.998	cell communication
GO:0051716	0.998	cellular response to stimulus
GO:0050794	0.998	regulation of cellular process
GO:0048584	0.990	positive regulation of response to stimulus
GO:0019221	0.987	cytokine-mediated signaling pathway
GO:0009966	0.963	regulation of signal transduction
GO:0048522	0.949	positive regulation of cellular process
GO:0009967	0.901	positive regulation of signal transduction
GO:0051239	0.893	regulation of multicellular organismal process
GO:0009893	0.855	positive regulation of metabolic process
GO:0060255	0.818	regulation of macromolecule metabolic process
GO:0010604	0.807	positive regulation of macromolecule metabolic process
GO:0051171	0.805	regulation of nitrogen compound metabolic process
GO:0080090	0.800	regulation of primary metabolic process
GO:0031325	0.778	positive regulation of cellular metabolic process
GO:0042981	0.735	regulation of apoptotic process
GO:0051173	0.695	positive regulation of nitrogen compound metabolic process
GO:0051246	0.666	regulation of protein metabolic process
GO:1902531	0.587	regulation of intracellular signal transduction
GO:1902533	0.567	positive regulation of intracellular signal transduction
GO:0051247	0.498	positive regulation of protein metabolic process
GO:0010468	0.494	regulation of gene expression
GO:0010942	0.459	positive regulation of cell death
GO:0019220	0.423	regulation of phosphate metabolic process
GO:0042325	0.412	regulation of phosphorylation
GO:0009605	0.406	response to external stimulus
GO:0031399	0.403	regulation of protein modification process
GO:0043065	0.401	positive regulation of apoptotic process
GO:0009607	0.396	response to biotic stimulus
GO:0051707	0.392	response to other organism
GO:0001934	0.388	positive regulation of protein phosphorylation
GO:0006950	0.385	response to stress
GO:0002376	0.367	immune system process
GO:0006952	0.365	defense response
GO:0080134	0.365	regulation of response to stress
GO:2001233	0.359	regulation of apoptotic signaling pathway
GO:0051240	0.350	positive regulation of multicellular organismal process
GO:0042127	0.343	regulation of cell population proliferation
GO:0050730	0.302	regulation of peptidyl-tyrosine phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005576	0.686	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]